Q9H169 STMN4_HUMAN
Gene name: STMN4
Protein name: Stathmin-4
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cytoskeleton organization GO:0007010
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P53618 | COPB1 | 0.99741 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 protein transport GO:0015031 ... |
| 2 | Q00688 | FKBP3 | 0.92314 | |
| 3 | P12882 | MYH1 | 0.87725 | |
| 4 | P16591 | FER | 0.85522 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 5 | Q6ZS27 | ZNF662 | 0.85206 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | O43529 | CHST10 | 0.84392 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell adhesion GO:0007155 |
| 7 | Q9Y623 | MYH4 | 0.83845 | |
| 8 | P46721 | SLCO1A2 | 0.8368 | transport GO:0006810 |
| 9 | Q96L12 | CALR3 | 0.83509 | cell differentiation GO:0030154 protein folding GO:0006457 reproduction GO:0000003 ... |
| 10 | P61254 | RPL26 | 0.81231 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIELNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEA STMI: DO_DISOPRED3: DD........................................................................DDDDDDDDDDDDD............. DO_IUPRED2A: ..............................................................................DD...DD.D..DDDDDDD.DD. DO_SPOTD: DD............................DD.D.DD............................................................... CONSENSUS: DD............................................................................DDDDDDDDD............. CONSENSUS_MOBI: ................................................D.......................DDDDDDDDDDDDDDD.............
120 140 160 180 AA: AEERRKYQEAELLKHLAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKHAEEVRKNKELKEEASR STMI: DO_DISOPRED3: ........................DDDDDDD............D...................................DDDDDDDDDD DO_IUPRED2A: ...........DD.D........DDDDD.........D..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: ..................................................................D..DDDDDDDDDDDDDDDDDDDD CONSENSUS: ........................DDDD...............D......................DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .....................................................................................DDDD RICH_[E]: EkdkhaEEvrknkElkEE RICH_[K]: KdKhaeevrKnKelK RICH_[EK]: EKdKhaEEvrKnKElKEE