Q01718 ACTHR_HUMAN
Gene name: MC2R
Protein name: Adrenocorticotropic hormone receptor
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- reproduction GO:0000003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P30968 | GNRHR | 0.98492 | anatomical structure development GO:0048856 signal transduction GO:0007165 |
| 2 | Q96BQ5 | CCDC127 | 0.83367 | |
| 3 | O14718 | RRH | 0.82811 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 |
| 4 | Q5TAH2 | SLC9C2 | 0.75024 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | Q9BTT6 | LRRC1 | 0.74069 | cell adhesion GO:0007155 protein transport GO:0015031 transport GO:0006810 ... |
| 6 | Q9Y3Q7 | ADAM18 | 0.73915 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 7 | Q99463 | NPY6R | 0.73208 | |
| 8 | Q86YD3 | TMEM25 | 0.71169 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 |
| 9 | Q16552 | IL17A | 0.70977 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 10 | Q96CM3 | RPUSD4 | 0.70977 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
20 40 60 80 100 AA: MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFET STMI: MMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDD.. ......... ..................... CONSENSUS_MOBI: ....................... ......... ..................... RICH_[N]: NsyeNiNNtarNN RICH_[IN]: IINsyeNINNtarNN RICH_fLPS_[N]: mkhiiNsyeNiNNtarNNsd
120 140 160 180 200 AA: TADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLA STMI: MMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .... ..................... ............ . CONSENSUS_MOBI: .... ..................... ............ .
220 240 260 280 AA: RSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW STMI: MMMMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ................................................................................................. DO_IUPRED2A: ................................................................................................. DO_SPOTD: .......DD.......................................................................................D CONSENSUS: ................. ............ ................... CONSENSUS_MOBI: ................. ............ ...................