Q16552 IL17_HUMAN
Gene name: IL17A
Protein name: Interleukin-17A
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96BQ5 | CCDC127 | 0.73106 | |
| 2 | Q01718 | MC2R | 0.70977 | anatomical structure development GO:0048856 reproduction GO:0000003 signal transduction GO:0007165 |
| 3 | Q99463 | NPY6R | 0.70888 | |
| 4 | O14718 | RRH | 0.70711 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 |
| 5 | P30968 | GNRHR | 0.69296 | anatomical structure development GO:0048856 signal transduction GO:0007165 |
| 6 | O75534 | CSDE1 | 0.69089 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 7 | Q9Y3Q7 | ADAM18 | 0.67078 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 8 | Q86YD3 | TMEM25 | 0.63551 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 |
| 9 | Q9BTT6 | LRRC1 | 0.63246 | cell adhesion GO:0007155 protein transport GO:0015031 transport GO:0006810 ... |
| 10 | Q5TAH2 | SLC9C2 | 0.61633 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 100 AA: MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCI STMI: SSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD.DD............................................................................. DO_IUPRED2A: .............................D.DDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD..................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............DDDDDDDDDD...................................... CONSENSUS: ......DDDDDDDD...............DDDDDDDDDD...................................... CONSENSUS_MOBI: DDDDDDDDD.................................................................... RICH_fLPS_[N]: NrNtNtNpkr
120 140 AA: NADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA STMI: DO_DISOPRED3: ....................................................DDD DO_IUPRED2A: ....................................................... DO_SPOTD: ......................................................D CONSENSUS: ......................................................D CONSENSUS_MOBI: ......................................................D