Q02045 MYL5_HUMAN
Gene name: MYL5
Protein name: Myosin light chain 5
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5JPE7 | NOMO2 | 0.90948 | |
| 2 | P69849 | NOMO3 | 0.81711 | |
| 3 | O94903 | PLPBP | 0.78353 | |
| 4 | Q12798 | CETN1 | 0.69142 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 5 | Q9Y5K5 | UCHL5 | 0.68966 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 6 | Q15125 | EBP | 0.68966 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 7 | Q15155 | NOMO1 | 0.66161 | |
| 8 | Q969F0 | FATE1 | 0.63789 | cell death GO:0008219 homeostatic process GO:0042592 |
| 9 | Q9BWS9 | CHID1 | 0.63734 | carbohydrate metabolic process GO:0005975 immune system process GO:0002376 response to stress GO:0006950 ... |
| 10 | P16402 | H1-3 | 0.63712 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD..DD..D.DDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDD..D.....................D.............................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................ RICH_[AK]: AsrKtKKKeggAlrAqrA RICH_MOBI_[AK]: AsrKtKKKeggAlrAqrA
120 140 160 AA: AEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE STMI: DO_DISOPRED3: .....................................................................DDDD DO_IUPRED2A: .......................................................................D. DO_SPOTD: ....................................................................DDDDD CONSENSUS: .....................................................................DDDD CONSENSUS_MOBI: .........................................................................