Q12798 CETN1_HUMAN
Gene name: CETN1
Protein name: Centrin-1
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cytoskeleton organization GO:0007010
- DNA metabolic process GO:0006259
- mitotic cell cycle GO:0000278
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9BWS9 | CHID1 | 0.91756 | carbohydrate metabolic process GO:0005975 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | O94903 | PLPBP | 0.86822 | |
| 3 | Q969F0 | FATE1 | 0.81269 | cell death GO:0008219 homeostatic process GO:0042592 |
| 4 | P58550 | FXYD6P3 | 0.8104 | transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | P16402 | H1-3 | 0.80046 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | O00233 | PSMD9 | 0.78371 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q6NXT2 | H3-5 | 0.77895 | growth GO:0040007 |
| 8 | P07305 | H1-0 | 0.76155 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 9 | Q9BY44 | EIF2A | 0.75511 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q70YC5 | ZNF365 | 0.74928 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDDD.D....................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... RICH_[AK]: AsgfKKpsAAstgqKrKvA RICH_[K]: KKpsaastgqKrKvapK RICH_MOBI_[AK]: AsgfKKpsAAstgqKrKvA RICH_MOBI_[K]: KKpsaastgqKrKvapK
120 140 160 AA: DTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY STMI: DO_DISOPRED3: ......................................DDDDDDDDDDDDDDDDD................. DO_IUPRED2A: .................................DD..DDDDDDDDDDDDDDDDD..DDDD............ DO_SPOTD: .....................................................................DDD CONSENSUS: ......................................DDDDDDDDDDDDDDDD.................. CONSENSUS_MOBI: ........................................................................ RICH_fLPS_[D]: DeelqemiDeaDrDgD