Q07812 BAX_HUMAN
Gene name: BAX
Protein name: Apoptosis regulator BAX
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- DNA metabolic process GO:0006259
- embryo development GO:0009790
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H223 | EHD4 | 0.89443 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 2 | Q92911 | SLC5A5 | 0.87622 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q8NHA8 | OR1F12 | 0.83957 | signal transduction GO:0007165 |
| 4 | P04629 | NTRK1 | 0.81373 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q14240 | EIF4A2 | 0.7928 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9NRM2 | ZNF277 | 0.76822 | response to stress GO:0006950 |
| 7 | P36406 | TRIM23 | 0.76597 | biological process involved in symbiotic interaction GO:0044403 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 8 | Q5T319 | FAM182B | 0.72161 | |
| 9 | Q9NZ38 | IDI2-AS1 | 0.70711 | |
| 10 | Q9Y263 | PLAA | 0.70711 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF STMI: DO_DISOPRED3: DDDDDDDDDDDDDD...................................D.D................................................ DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDD................................................. DO_SPOTD: DDDDDDDDDDDDDDDD......................DDDDDDDDDDDDDDD............................................... CONSENSUS: DDDDDDDDDDDDDDDD........................DDDDDDDDDDDD................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GsGeqprGGG
120 140 160 180 AA: SDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ............................................................................DD.............. DO_IUPRED2A: ............................................................................................ DO_SPOTD: ............................................................................................ CONSENSUS: ....................................................................... CONSENSUS_MOBI: .......................................................................