List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	P23975	SLC6A2	0.92258	cell-cell signaling GO:0007267 homeostatic process GO:0042592 response to stress GO:0006950 ...
2	Q9UIJ5	ZDHHC2	0.74879	biosynthetic process GO:0009058 catabolic process GO:0009056 cell adhesion GO:0007155 ...
3	Q9BXU0	TEX12	0.46788	biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ...
4	O60684	KPNA6	0.41993	biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ...
5	Q05048	CSTF1	0.39253
6	Q07837	SLC3A1	0.37296	carbohydrate metabolic process GO:0005975 transport GO:0006810
7	Q9Y284	WDR83OS	0.36623
8	Q969I6	SLC38A4	0.36395	transmembrane transport GO:0055085 transport GO:0006810
9	Q15842	KCNJ8	0.36081	circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810
10	Q9HCX4	TRPC7	0.34595	homeostatic process GO:0042592 reproduction GO:0000003 response to stress GO:0006950 ...

                                           20                  40                  60                  80     
AA:                      MNNSFNKEDRMSSDTMVGSCDRQTKNGAKWHGGVSSLLDFTLIYIQLSTSFQNAGHSFKKQHICSDFEVMDELSCAVYGNKFYYLLPTLTHPSIQ
STMI:                                                                                                                   
DO_DISOPRED3:            DDDDDDDDDD...................................................................................DD
DO_IUPRED2A:             ..DDDD.........DDDD............................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................DDD
CONSENSUS:               DDDDDDDDDD.....DDDD..........................................................................DD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD...........................................................................
RICH_MOBI_[MN]:          MNNsfNkedrMssdtM