Q0VG73 YC023_HUMAN
Protein name: Putative uncharacterized protein LOC152225
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P23975 | SLC6A2 | 0.92258 | cell-cell signaling GO:0007267 homeostatic process GO:0042592 response to stress GO:0006950 ... |
| 2 | Q9UIJ5 | ZDHHC2 | 0.74879 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell adhesion GO:0007155 ... |
| 3 | Q9BXU0 | TEX12 | 0.46788 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 4 | O60684 | KPNA6 | 0.41993 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q05048 | CSTF1 | 0.39253 | |
| 6 | Q07837 | SLC3A1 | 0.37296 | carbohydrate metabolic process GO:0005975 transport GO:0006810 |
| 7 | Q9Y284 | WDR83OS | 0.36623 | |
| 8 | Q969I6 | SLC38A4 | 0.36395 | transmembrane transport GO:0055085 transport GO:0006810 |
| 9 | Q15842 | KCNJ8 | 0.36081 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | Q9HCX4 | TRPC7 | 0.34595 | homeostatic process GO:0042592 reproduction GO:0000003 response to stress GO:0006950 ... |
20 40 60 80 AA: MNNSFNKEDRMSSDTMVGSCDRQTKNGAKWHGGVSSLLDFTLIYIQLSTSFQNAGHSFKKQHICSDFEVMDELSCAVYGNKFYYLLPTLTHPSIQ STMI: DO_DISOPRED3: DDDDDDDDDD...................................................................................DD DO_IUPRED2A: ..DDDD.........DDDD............................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................DDD CONSENSUS: DDDDDDDDDD.....DDDD..........................................................................DD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD........................................................................... RICH_MOBI_[MN]: MNNsfNkedrMssdtM