Q9Y284 ASTER_HUMAN
Gene name: WDR83OS
Protein name: Protein Asterix
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P60606 | CTXN1 | 0.75698 | |
| 2 | Q96QK8 | SMIM14 | 0.75698 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 3 | Q16613 | AANAT | 0.75653 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | A0PG75 | PLSCR5 | 0.75575 | membrane organization GO:0061024 plasma membrane organization GO:0007009 transport GO:0006810 |
| 5 | Q14626 | IL11RA | 0.75361 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 signal transduction GO:0007165 |
| 6 | P50281 | MMP14 | 0.74844 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 7 | O75880 | SCO1 | 0.74689 | catabolic process GO:0009056 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 8 | Q8IY18 | SMC5 | 0.74589 | cell cycle GO:0007049 cell division GO:0051301 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q9BQI0 | AIF1L | 0.73031 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 |
| 10 | Q9Y4U1 | MMACHC | 0.70279 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
20 40 60 80 100 AA: MSTNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLMLKLKWCAWVAVYCSFISFANSRSSEDTKQMMSSFMLSISAVVMSYLQNPQ STMI: MMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDD........DDDDD........................................................................ DO_IUPRED2A: DDDDDDD..DDDDDDDDD...D..D...D....................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................DD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......... ................. .... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......... ................. .... RICH_[N]: NNmsdprrpN RICH_[P]: PrrPnkvlrykPPPsecnP RICH_[MN]: MstNNMsdprrpN RICH_MOBI_[N]: NNmsdprrpN RICH_MOBI_[P]: PrrPnkvlrykPPPsecnP RICH_MOBI_[MN]: MstNNMsdprrpN
AA: PMTPPW STMI: DO_DISOPRED3: ....DD DO_IUPRED2A: .....D DO_SPOTD: DDDDDD CONSENSUS: ....DD CONSENSUS_MOBI: ......