Q13277 STX3_HUMAN
Gene name: STX3
Protein name: Syntaxin-3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- membrane organization GO:0061024
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P13010 | XRCC5 | 0.9847 |
anatomical structure development
GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
2 | Q6ZQY3 | GADL1 | 0.79053 |
biosynthetic process
GO:0009058 catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
3 | O75558 | STX11 | 0.77053 |
cell-cell signaling
GO:0007267 membrane organization GO:0061024 protein transport GO:0015031 ... |
4 | Q9BVV2 | FNDC11 | 0.74507 | |
5 | Q9UK12 | ZNF222 | 0.73359 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
6 | P52434 | POLR2H | 0.72392 |
biological process involved in symbiotic interaction
GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
7 | Q9Y6J8 | STYXL1 | 0.72392 |
anatomical structure development
GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
8 | Q8N485 | LIX1 | 0.72392 |
catabolic process
GO:0009056 |
9 | P43630 | KIR3DL2 | 0.72282 |
cell death
GO:0008219 immune system process GO:0002376 response to stress GO:0006950 |
10 | Q9NQ34 | TMEM9B | 0.69191 |
signal transduction
GO:0007165 |
20 40 60 80 100
AA: MKDRLEQLKAKQLTQDDDTDAVEIAIDNTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSIILSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEK
STMI:
DO_DISOPRED3: D.D..DDDDDDDDDDDDDDDDD..............................................................................
DO_IUPRED2A: .....DDDDDDDD.....DD...D..............................................DDDDDDDDDDDDDD...DD.D.DDDDDDDD
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD...........................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
CONSENSUS_MOBI: ....................................................................................................
RICH_[D]: DrleqlkakqltqDDDtD
RICH_[DQ]: DrleQlkakQltQDDDtD
RICH_fLPS_[D]: kqltqDDDtD
120 140 160 180 200
AA: HIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKD
STMI:
DO_DISOPRED3: ....................................................................................................
DO_IUPRED2A: DDDD.DDDDDD..............................D.......DDDDDDDDD.DDDDDDDDDDD..............................
DO_SPOTD: ....................................................................................................
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ....................................................................................................
220 240 260 280
AA: IVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVKYQSQARKKLIIIIVLVVVLLGILALIIGLSVGLN
STMI: MMMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3: .........................................................DDDDD..DD.DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A: .........................................................................................
DO_SPOTD: ....................................................................................DDDDD
CONSENSUS: ............................................................... DDDDD
CONSENSUS_MOBI: ............................................................... .....