Q13352 CENPR_HUMAN

Gene name: ITGB3BP
Protein name: Centromere protein R

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q14563 SEMA3A 0.77403 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
2 Q8WTZ3 n/a 0.75223
3 P56545 CTBP2 0.738 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q14439 GPR176 0.68386 cell-cell signaling GO:0007267
signal transduction GO:0007165
5 Q8NEA5 C19orf18 0.67152
6 Q5MJ07 SPANXN5 0.67004
7 Q5VU57 AGBL4 0.66771 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
8 Q5JVX7 C1orf141 0.65813
9 O60281 ZNF292 0.64207 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
10 Q8TF27 AGAP11 0.6396

                                           20                  40                  60                  80                 100
AA:                      MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEI
STMI:                                                                                                                        
DO_DISOPRED3:            DD.....DDDDD........D.................................DDDDDDDDDDDDDDDDDDDDD.DD......................
DO_IUPRED2A:             D....DD..DDD.....D.....DDD..DD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS:               DDDDDDDDDDDD.....DDDDDDDDDDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
CONSENSUS_MOBI:          ........................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
RICH_[K]:                                                                     KhrnglsneKrKK                                  
RICH_[HN]:                                                                     HrNglsNekrkklNH                               
RICH_[KN]:                                                                       NglsNeKrKK                                  
RICH_MOBI_[K]:                                                                KhrnglsneKrKK                                  
RICH_MOBI_[N]:                                                                   NglsNekrkklN                                
RICH_MOBI_[HN]:                                                                HrNglsNekrkklNH                               
RICH_MOBI_[KN]:                                                                  NglsNeKrKK                                  

                                          120                 140                 160   
AA:                      MEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN
STMI:                                                                                                 
DO_DISOPRED3:            .............................................................................
DO_IUPRED2A:             .....................................DDD..DDDDD.DDD.DDD.DD...................
DO_SPOTD:                .............................................................................
CONSENSUS:               .............................................................................
CONSENSUS_MOBI:          .............................................................................