Q5MJ07 SPXN5_HUMAN

Gene name: SPANXN5
Protein name: Sperm protein associated with the nucleus on the X chromosome N5

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UJN7 ZNF391 0.90843
2 Q9HAN9 NMNAT1 0.85356 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
3 Q4W5G0 TIGD2 0.85321
4 Q9H3H1 TRIT1 0.84937 cellular nitrogen compound metabolic process GO:0034641
5 Q8WV22 NSMCE1 0.8477 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
...
6 Q6ZNX1 SHLD3 0.84621 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
7 Q3ZM63 ETDA 0.84559
8 A0A1B0GVM5 ETDC 0.84489
9 Q96PP4 TSGA13 0.84219
10 A0AVF1 TTC26 0.84198 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...

                                           20                  40                  60        
AA:                      MEKPTSSTNGEKRKSPCDSNSKNDEMQETPNRDLVLEPSLKKMKTSEYSTVLVLCYRKTKKIHSNQLENDQS
STMI:                                                                                            
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD................................................DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............D.DDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
RICH_[K]:                  KptsstngeKrKspcdsnsK                                                  
RICH_MOBI_[K]:             KptsstngeKrKspcdsnsK                                                  
RICH_MOBI_[N]:                   NgekrkspcdsNskN