Q13432 U119A_HUMAN

Gene name: UNC119
Protein name: Protein unc-119 homolog A

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
- cell division GO:0051301
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- mitotic cell cycle GO:0000278
- nervous system process GO:0050877
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P11474 ESRRA 0.81727 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q14332 FZD2 0.7585 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 Q8IYS8 BOD1L2 0.74832 cell cycle GO:0007049
cell division GO:0051301
cellular protein modification process GO:0006464
4 A0A1B0GVM6 C11orf97 0.74439
5 Q6ZSJ8 C1orf122 0.72933
6 Q6IPT2 FAM71E1 0.72065
7 Q96IS3 RAX2 0.71921 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
nervous system process GO:0050877
8 Q96IF1 AJUBA 0.7168 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
9 P84550 SKOR1 0.71574 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
signal transduction GO:0007165
10 O14908 GIPC1 0.71121 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...

                                           20                  40                  60                  80                 100
AA:                      MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......D............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................
RICH_[AG]:                     GGGAGtAtesApGpsGqsvA                                                                          
RICH_[AP]:                        AgtAtesAPgPsgqsvAPiP                                                                       
RICH_[G]:                     GGGGaGtatesapGpsG                                                                              
RICH_[P]:                                 PgPsgqsvaPiPqPP                                                                    
RICH_[EG]:                                                EsEsGsEsEpdaGpGprpG                                                
RICH_[EP]:                                         PiPqPPaEsEsgsEsEPdagPgPrPgP                                               
RICH_[GK]:                KvKKGGGGaG                                                                                         
RICH_[GP]:                                                    GsesePdaGPGPrPGP                                               
RICH_fLPS_[G]:            kvkkGGGGaGtatesapGpsG                                                                              
RICH_MOBI_[AG]:                GGGAGtAtesApGpsGqsvA                                                                          
RICH_MOBI_[G]:                GGGGaGtatesapGpsG                                                                              
RICH_MOBI_[P]:                            PgPsgqsvaPiPqPP                                                                    
RICH_MOBI_[EG]:                                           EsEsGsEsEpdaGpGprpG                                                
RICH_MOBI_[GK]:           KvKKGGGGaG                                                                                         
RICH_MOBI_[GP]:                                                    PdaGPGPrPGP                                               
RICH_fLPS_MOBI_[G]:       kvkkGGGGaGtatesapGpsG                                                                              

                                          120                 140                 160                 180                 200
AA:                      VLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLS
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             .............DDDDD..................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          .........D..........................................................................................

                                          220
AA:                      EELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
STMI:                                                            
DO_DISOPRED3:            ........................................
DO_IUPRED2A:             ........................................
DO_SPOTD:                ......................................DD
CONSENSUS:               ........................................
CONSENSUS_MOBI:          .......................................D