Q96IS3 RAX2_HUMAN

Gene name: RAX2
Protein name: Retina and anterior neural fold homeobox protein 2

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- nervous system process GO:0050877

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P11474 ESRRA 0.78366 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q96IF1 AJUBA 0.776 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
3 Q14549 GBX1 0.72229 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
4 Q13432 UNC119 0.71921 anatomical structure development GO:0048856
cell cycle GO:0007049
cell division GO:0051301
...
5 Q8WXA8 HTR3C 0.70603 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
6 Q9HAW0 BRF2 0.70502 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
7 O14908 GIPC1 0.69584 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
8 O60755 GALR3 0.69479 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
9 Q9UNE7 STUB1 0.69238 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 Q96C00 ZBTB9 0.68772 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80                 100
AA:                      MFLSPGEGPATEGGGLGPGEEAPKKKHRRNRTTFTTYQLHQLERAFEASHYPDVYSREELAAKVHLPEVRVQVWFQNRRAKWRRQERLESGSGAVAAPRL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................DDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D............................................DDDDDDDDDDDDD.DD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDD...D....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................DDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
RICH_[AL]:                                                                                                                  L
RICH_[AP]:                                                                                                            AvAAPrl
RICH_[A]:                                                                                                             AvAAprl
RICH_[G]:                     GeGpateGGGlGpG                                                                                 
RICH_[P]:                                                                                                                 Prl
RICH_[R]:                                                                                                  RRqeRlesgsgavaapR 
RICH_[EG]:                    GEGpatEGGGlGpGEE                                                                               
RICH_[EP]:                   PgEgPatEggglgPgEEaP                                                                             
RICH_[GP]:                   PGeGPateGGGlGPGeeaP                                                                             
RICH_[LP]:                                                                                                                  L
RICH_fLPS_[G]:           mflspGeGpateGGGlGpGe                                                                                
RICH_MOBI_[G]:                GeGpateGGGlGpG                                                                                 
RICH_MOBI_[EG]:               GEGpatEGGGlGpGEE                                                                               
RICH_fLPS_MOBI_[G]:      mflspGeGpateGGGlGpGe                                                                                

                                          120                 140                 160                 180                
AA:                      PEAPALPFARPPAMSLPLEPWLGPGPPAVPGLPRLLGPGPGLQASFGPHAFAPTFADGFALEEASLRLLAKEHAQALDRAWPPA
STMI:                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
DO_IUPRED2A:             DDDDDDDDDD......DDDDD..D....DDDDDDD....D......DD..............................DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....D.........DDDDDDDD.DDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDD
CONSENSUS_MOBI:          ....................................................................................
RICH_[AG]:                                                   GpGpGlqAsfGphAfAptfA                            
RICH_[AL]:               peApALpfArppAmsLpL                                                                  
RICH_[AP]:               PeAPAlPfArPPAmslPleP                 PgPglqAsfgPhAfAPtfA                            
RICH_[A]:                peApAlpfArppA                                                                       
RICH_[F]:                                                             FgphaFaptF                             
RICH_[G]:                                      GpGppavpGlprllGpGpG                                           
RICH_[P]:                PeaPalPfarPPamslPlePwlgPgPPavPglPrllgPgP                                            
RICH_[GL]:                                LepwLGpGppavpGLprLLGpGpGLqasfG                                     
RICH_[GP]:                                  PwlGPGPPavPGlPrllGPGPGlqasfGPhafaP                               
RICH_[LP]:               PeaPaLPfarPPamsLPL   LgPgPPavPgLPrLLgPgPgLqasfgP                                    
RICH_fLPS_[F]:                                                        FgphaFaptF