Q13536 CROC4_HUMAN
Gene name: MIR9-1HG
Protein name: Protein CROC-4
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5JU00 | TCTE1 | 0.83925 | reproduction GO:0000003 |
| 2 | Q9H1K4 | SLC25A18 | 0.83508 | generation of precursor metabolites and energy GO:0006091 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | A8MVS5 | HIDE1 | 0.83469 | |
| 4 | Q32NC0 | C18orf21 | 0.83112 | |
| 5 | P98088 | MUC5AC | 0.81656 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 6 | Q08708 | CD300C | 0.79511 | immune system process GO:0002376 response to stress GO:0006950 |
| 7 | Q5SSG8 | MUC21 | 0.78947 | biosynthetic process GO:0009058 cell adhesion GO:0007155 cellular protein modification process GO:0006464 ... |
| 8 | P40200 | CD96 | 0.78149 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 |
| 9 | Q9NZJ4 | SACS | 0.75223 | cellular component assembly GO:0022607 protein folding GO:0006457 |
| 10 | Q9UKN1 | MUC12 | 0.74426 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 growth GO:0040007 ... |
20 40 60 80 100 AA: MFLTEDLITFNLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSSPRPPGSTSHCGISTRCTERCLCVLPLRTSQVPDVMAPQHD STMI: DO_DISOPRED3: D..D................................................DDDDDDDDDD...................................... DO_IUPRED2A: ..............................................DD..DDDDDDDDDDDDDDD..DD.......................D.D.D... DO_SPOTD: DD..........................................DDDDDDDDDDDDDDDDDDDDDDDDD............................... CONSENSUS: D.............................................DDDDDDDDDDDDDDDDDDDDDDD............................... CONSENSUS_MOBI: ............................................DDDDDDDDDDDDDDDDDDDDDDDDDDD............................. RICH_[PS]: SSttdSSraPSSPrPPgStS RICH_[PT]: TssTTdssraPssPrPPgsT RICH_[S]: SSttdSSrapSSprppgStS RICH_[T]: TssTTdssrapssprppgsT RICH_[ST]: TSSTTdSSrapSSprppgST RICH_MOBI_[S]: SSttdSSrapSSprppgStS RICH_MOBI_[T]: TssTTdssrapssprppgsT RICH_MOBI_[ST]: TSSTTdSSrapSSprppgST
120 140 AA: QEKFHDLAYSCLGKSFSMSNQDLYGYSTSSLALGLAWLSWETKKKNVLHLVGLDSL STMI: DO_DISOPRED3: .......................................................D DO_IUPRED2A: ........................................................ DO_SPOTD: .....................................................DDD CONSENSUS: .......................................................D CONSENSUS_MOBI: ........................................................