Q13542 4EBP2_HUMAN

Gene name: EIF4EBP2
Protein name: Eukaryotic translation initiation factor 4E-binding protein 2

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- nervous system process GO:0050877
- signal transduction GO:0007165
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95273 CCNDBP1 0.64996 cell cycle GO:0007049
2 Q8N292 GAPT 0.53531 cell population proliferation GO:0008283
homeostatic process GO:0042592
immune system process GO:0002376
3 P16284 PECAM1 0.51555 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
4 Q12893 TMEM115 0.48772 cell population proliferation GO:0008283
protein transport GO:0015031
transport GO:0006810
...
5 P31152 MAPK4 0.48521 cell cycle GO:0007049
cellular protein modification process GO:0006464
signal transduction GO:0007165
6 A4FU28 CTAGE9 0.47308 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
7 Q16534 HLF 0.47227 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 O94763 URI1 0.47084 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
9 Q5FWF7 FBXO48 0.46765 catabolic process GO:0009056
10 P25101 EDNRA 0.46342 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNN
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD......................................................DD..............DDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDD...DDDD...DDDDDDDD...DD......DDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDD..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDD................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                                                                                 PmaqtPPchlPniPgvtsP                
RICH_[S]:                 SSSagSghqpSqS                                                                                      
RICH_[DN]:                                                                                                                 NN
RICH_[HN]:                                                                                                              NNlNN
RICH_fLPS_[N]:                                                                                              pgtliedskvevNNlNN
RICH_MOBI_[P]:                                                                            PmaqtPPchlPniPgvtsP                
RICH_MOBI_[S]:            SSSagSghqpSqS                                                                                      
RICH_MOBI_[DN]:                                                                                                            NN
RICH_MOBI_[HN]:                                                                                                         NNlNN
RICH_MOBI_[LN]:                                                                                                LiedskvevNNLNN
RICH_MOBI_[NV]:                                                                                                      VeVNNlNN
RICH_fLPS_MOBI_[N]:                                                                                         pgtliedskvevNNlNN