Q5FWF7 FBX48_HUMAN
Gene name: FBXO48
Protein name: F-box only protein 48
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96GC9 | VMP1 | 0.9526 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell adhesion GO:0007155 ... |
| 2 | A8MYZ0 | MINDY4B | 0.90939 | |
| 3 | Q9NYP7 | ELOVL5 | 0.86216 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 4 | Q8N292 | GAPT | 0.79976 | cell population proliferation GO:0008283 homeostatic process GO:0042592 immune system process GO:0002376 |
| 5 | P16284 | PECAM1 | 0.77082 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | O95273 | CCNDBP1 | 0.76378 | cell cycle GO:0007049 |
| 7 | O75317 | USP12 | 0.73951 | catabolic process GO:0009056 cellular protein modification process GO:0006464 |
| 8 | O75409 | H2AP | 0.72757 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 9 | Q9NZJ9 | NUDT4 | 0.72471 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P62068 | USP46 | 0.70688 | catabolic process GO:0009056 cell-cell signaling GO:0007267 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... RICH_[N]: NskrNNNlrvshteaN RICH_[HN]: HkNskrNNNlrvsH RICH_fLPS_[N]: mhkNskrNNNlrvshteaNs RICH_MOBI_[N]: NskrNNNlrvshteaN RICH_MOBI_[HN]: HkNskrNNNlrvsH RICH_fLPS_MOBI_[N]: mhkNskrNNNlrvshteaNs
120 140 AA: WRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER STMI: DO_DISOPRED3: ......................................................D DO_IUPRED2A: ....................................................... DO_SPOTD: ....................................................... CONSENSUS: ....................................................... CONSENSUS_MOBI: .......................................................