Q15038 DAZP2_HUMAN

Gene name: DAZAP2
Protein name: DAZ-associated protein 2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q01085 TIAL1 0.77392 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
2 Q9Y6Y8 SEC23IP 0.68582 cellular component assembly GO:0022607
membrane organization GO:0061024
protein transport GO:0015031
...
3 Q92945 KHSRP 0.67656 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
4 Q8N5C8 TAB3 0.67352 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 Q7Z429 GRINA 0.66889 cell death GO:0008219
homeostatic process GO:0042592
response to stress GO:0006950
...
6 P05549 TFAP2A 0.66087 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 O14497 ARID1A 0.65852 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 P53992 SEC24C 0.65692 cellular component assembly GO:0022607
immune system process GO:0002376
membrane organization GO:0061024
...
9 O60830 TIMM17B 0.65387 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...
10 P50995 ANXA11 0.64286 cell cycle GO:0007049
cell division GO:0051301
transport GO:0006810
...

                                           20                  40                  60                  80                 100
AA:                      MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD..DD.............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDD...........................................................................
RICH_[PQ]:                    QyPtQPtyPvQPPgnPvyPQ                                                                           
RICH_[PY]:                     YPtqPtYPvqPPgnPvYPqtlhlPqaPPYtdaPPaYselYrPsfvhPgaatvP                      PlgstiPmaYYPvgPiYPP
RICH_[QY]:                    QYptQptYpvQppgnpvYpQ                                                                           
RICH_[AP]:                                              APPytdAPPAyselyrPsfvhPgAA                                            
RICH_[AY]:                                                    AppAYselYrpsfvhpgAA                                            
RICH_[A]:                                                                      AAtvptmsAAfpgA                                
RICH_[P]:                       PtqPtyPvqPPgnPvyPqtlhlPqaPP                                               PlgstiPmayyPvgPiyPP
RICH_[Q]:                     QyptQptypvQppgnpvypQ                                                                           
RICH_[Y]:                                                  YtdappaYselY                                            YYpvgpiYpp
RICH_[VY]:                                                                                                          YpVgpiYpp
RICH_[GP]:                                                                                                           PvGPiyPP
RICH_[GY]:                                                                                                         YYpvGpiYpp
RICH_[IP]:                                                                                                     IPmayyPvgPIyPP
RICH_[IY]:                                                                                                     IpmaYYpvgpIY  
RICH_fLPS_[Y]:                                          appYtdappaYselY                                     gstipmaYYpvgpiYpp
RICH_MOBI_[PQ]:               QyPtQPtyPvQPPgnPvyPQ                                                                           
RICH_MOBI_[PV]:                       PVqPPgnPVyP                                                                            
RICH_MOBI_[PY]:                YPtqPtYPvqPPgnPvYP                                                                            
RICH_MOBI_[QY]:               QYptQptYpvQppgnpvYpQ                                                                           
RICH_MOBI_[P]:                  PtqPtyPvqPPgnPvyP                                                                            
RICH_MOBI_[Q]:                QyptQptypvQppgnpvypQ                                                                           
RICH_fLPS_MOBI_[Y]:         kgqYptqptYpvqppgnpvY                                                                             

                                          120                 140                 160            
AA:                      GSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
STMI:                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........D.....
DO_IUPRED2A:             ...................DDDDDDDDDDDD.DD.DD...............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDD.
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................D.....
CONSENSUS_MOBI:          ....................................................................
RICH_[PY]:               gstvlveggY                                                          
RICH_[AG]:               GstvlveGGydAGArfGAGAtAGnipppppG                                     
RICH_[AP]:                          AgArfgAgAtAgniPPPPPgcP                                   
RICH_[A]:                           AgArfgAgAtA                                              
RICH_[G]:                GstvlveGGydaGarfGaGataG                                             
RICH_[Y]:                gstvlveggY                                                          
RICH_[VY]:               gstVlV                                                              
RICH_[GP]:               GstvlveGG   GarfGaGataGniPPPPPGcPP                                  
RICH_[GY]:               GstvlveGGYdaGarfG                                                   
RICH_fLPS_[P]:                              atagniPPPPPgcPP                                  
RICH_fLPS_[A]:                      AgArfgAgAtA                                              
RICH_fLPS_[Y]:           gstvlveggY