O60830 TI17B_HUMAN

Gene name: TIMM17B
Protein name: Mitochondrial import inner membrane translocase subunit Tim17-B

List of terms from Generic GO subset, which this protein is a part of:
- protein targeting GO:0006605
- protein transport GO:0015031
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95832 CLDN1 0.91267 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
2 Q8N4L2 PIP4P2 0.79677 transport GO:0006810
vesicle-mediated transport GO:0016192
3 Q99439 CNN2 0.78158 cytoskeleton organization GO:0007010
immune system process GO:0002376
signal transduction GO:0007165
...
4 Q9HBD1 RC3H2 0.74749 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
5 A5D8V6 VPS37C 0.69351 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
6 Q93052 LPP 0.69171 cell adhesion GO:0007155
7 O14828 SCAMP3 0.68883 protein transport GO:0015031
transport GO:0006810
vesicle-mediated transport GO:0016192
8 O15162 PLSCR1 0.6838 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cell death GO:0008219
...
9 Q969X1 TMBIM1 0.68161 anatomical structure development GO:0048856
cell death GO:0008219
immune system process GO:0002376
...
10 Q96J86 CYYR1 0.665

                                           20                  40                  60                  80                 100
AA:                      MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTG
STMI:                                    MMMMMMMMMMMMMMMMMMMMM                       MMMMMMMMMMMMMMMMM                       
DO_DISOPRED3:            DD..................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDD...............................................................................................
CONSENSUS:               DD..............                     .......................                 .......................
CONSENSUS_MOBI:          ................                     .......................                 .......................

                                          120                 140                 160        
AA:                      AVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH
STMI:                                MMMMMMMMMMMMMMMMMMMMM                                       
DO_DISOPRED3:            ...............................................DDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................................DDDDDDDDDDDDDDDDDDDDDD....
DO_SPOTD:                .......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ............                     .............DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ............                     ............DDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PY]:                                                                 PsqlPPkdgtPaPgYPsYqqY 
RICH_[P]:                                                                  PsqlPPkdgtPaPgyP      
RICH_fLPS_[Y]:                                                                        apgYpsYqqY 
RICH_MOBI_[PY]:                                                            PsqlPPkdgtPaPgYPsY    
RICH_MOBI_[P]:                                                        PfledPsqlPPkdgtPaPgyP      
RICH_fLPS_MOBI_[Y]:                                                         sqlppkdgtpapgYpsYqqY