Q15053 K0040_HUMAN
Gene name: KIAA0040
Protein name: Uncharacterized protein KIAA0040
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZSB9 | ZBTB49 | 0.84022 |
biosynthetic process
GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 2 | P52333 | JAK3 | 0.83185 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 3 | Q8IVC4 | ZNF584 | 0.749 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | A0A1W2PPF3 | DUXB | 0.71723 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | P59091 | LINC00315 | 0.67068 | |
| 6 | Q9BZW7 | TSGA10 | 0.66706 |
cellular component assembly
GO:0022607 reproduction GO:0000003 |
| 7 | P49908 | SELENOP | 0.65918 |
anatomical structure development
GO:0048856 growth GO:0040007 reproduction GO:0000003 ... |
| 8 | Q6UXD1 | HRCT1 | 0.65569 | |
| 9 | Q8NFR9 | IL17RE | 0.64468 |
response to stress
GO:0006950 signal transduction GO:0007165 |
| 10 | Q8TDN1 | KCNG4 | 0.63286 |
cellular component assembly
GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
20 40 60 80 100
AA: MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIHLNMVPKCVHMHVTHTHTNSGSRYVG
STMI:
DO_DISOPRED3: DD..DDDDDDDDDDDDDDDDDD..............................................................................
DO_IUPRED2A: ....DDDDDDDDDDDDDDDDDDDDDDDD...............................DDDD.......................D.............
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................
CONSENSUS_MOBI: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
RICH_[Q]: QprnkpQtkcpsggQsQ
RICH_MOBI_[H]: HtpHakHkeHlsiH
RICH_fLPS_MOBI_[H]: pptclwHtpHakHkeHlsiH
120 140
AA: KYILLIKWSLAMYFVQGSTLSTVTKMSHGKALPDSDTYIQFPNQQGPHTPSIP
STMI:
DO_DISOPRED3: ..............................................DDDDDDD
DO_IUPRED2A: .........................DD.........DDDDD.DDDD..DDDDD
DO_SPOTD: ..........................................DDDDDDDDDDD
CONSENSUS: ..........................................DDDDDDDDDDD
CONSENSUS_MOBI: .....................................................