Q15053 K0040_HUMAN
Gene name: KIAA0040
Protein name: Uncharacterized protein KIAA0040
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZSB9 | ZBTB49 | 0.84022 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 2 | P52333 | JAK3 | 0.83185 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 3 | Q8IVC4 | ZNF584 | 0.749 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | A0A1W2PPF3 | DUXB | 0.71723 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | P59091 | LINC00315 | 0.67068 | |
| 6 | Q9BZW7 | TSGA10 | 0.66706 | cellular component assembly GO:0022607 reproduction GO:0000003 |
| 7 | P49908 | SELENOP | 0.65918 | anatomical structure development GO:0048856 growth GO:0040007 reproduction GO:0000003 ... |
| 8 | Q6UXD1 | HRCT1 | 0.65569 | |
| 9 | Q8NFR9 | IL17RE | 0.64468 | response to stress GO:0006950 signal transduction GO:0007165 |
| 10 | Q8TDN1 | KCNG4 | 0.63286 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 transmembrane transport GO:0055085 ... |
20 40 60 80 100 AA: MHYVHVHRVTTQPRNKPQTKCPSGGQSQGPRGQFLDTVLAAMCPIAMLLTADPGMPPTCLWHTPHAKHKEHLSIHLNMVPKCVHMHVTHTHTNSGSRYVG STMI: DO_DISOPRED3: DD..DDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: ....DDDDDDDDDDDDDDDDDDDDDDDD...............................DDDD.......................D............. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: .....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD................... RICH_[Q]: QprnkpQtkcpsggQsQ RICH_MOBI_[H]: HtpHakHkeHlsiH RICH_fLPS_MOBI_[H]: pptclwHtpHakHkeHlsiH
120 140 AA: KYILLIKWSLAMYFVQGSTLSTVTKMSHGKALPDSDTYIQFPNQQGPHTPSIP STMI: DO_DISOPRED3: ..............................................DDDDDDD DO_IUPRED2A: .........................DD.........DDDDD.DDDD..DDDDD DO_SPOTD: ..........................................DDDDDDDDDDD CONSENSUS: ..........................................DDDDDDDDDDD CONSENSUS_MOBI: .....................................................