P59091 CU093_HUMAN

Gene name: LINC00315
Protein name: Putative uncharacterized protein encoded by LINC00315

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IVC4 ZNF584 0.79662 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 Q6UXD1 HRCT1 0.75376
3 E5RJ46 C8orf87 0.69604
4 Q9BZW7 TSGA10 0.68964 cellular component assembly GO:0022607
reproduction GO:0000003
5 Q15053 KIAA0040 0.67068
6 Q96PX6 CCDC85A 0.6649
7 Q6ZSB9 ZBTB49 0.6607 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...
8 P49908 SELENOP 0.65003 anatomical structure development GO:0048856
growth GO:0040007
reproduction GO:0000003
...
9 P48454 PPP3CC 0.64493 anatomical structure development GO:0048856
cell death GO:0008219
cellular protein modification process GO:0006464
...
10 P04196 HRG 0.62947 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...

                                           20                  40                  60                  80                 100
AA:                      MDSLTERCRPQPLAALGPADAQLHGPAAAGGGVGPRVMLSSLCREHPWQGRCPPIPAHGKEVRQLRHLHRTRPPDTHQDMARGPGLPHTHGLPARPSHVR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD...............................................................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD.DDD........DD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                            AAlGpAdAqlhGpAAAGGG                                                                    
RICH_[AL]:                  LtercrpqpLAALgpAdAqL                                                                             
RICH_[AP]:                        PqPlAAlgPAdAqlhgPAAA                                                                       
RICH_[A]:                             AAlgpAdAqlhgpAAA                                                                       
RICH_[H]:                                                                                  HlHrtrppdtH          HtHglparpsHvr
RICH_[R]:                                                                              RqlRhlhRtRppdthqdmaR                  
RICH_[HP]:                                                                                                  PglPHtHglParPsHvr
RICH_[HR]:                                                                             RqlRHlHRtR                            
RICH_fLPS_[A]:                    pqplAAlgpAdAqlhgpAAA                                                                       
RICH_MOBI_[H]:                                                                                       HqdmargpglpHtHglparpsHvr
RICH_fLPS_MOBI_[H]:                                                                                       rgpglpHtHglparpsHvr

                                          120 
AA:                      HQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPALGA
STMI:                                                           
DO_DISOPRED3:            ......................................D
DO_IUPRED2A:             DDDDDDDDDDDD.....................D.DD.D
DO_SPOTD:                DDDD...........................DDDDDDDD
CONSENSUS:               DDDD.............................DDDDDD
CONSENSUS_MOBI:          DDDD...................................
RICH_[H]:                H                                      
RICH_[HP]:               H                                      
RICH_MOBI_[H]:           H                                      
RICH_fLPS_MOBI_[H]:      H