Q16082 HSPB2_HUMAN
Gene name: HSPB2
Protein name: Heat shock protein beta-2
List of terms from Generic GO subset, which this protein is a part of:
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A2A2Y4 | FRMD3 | 0.53585 | cytoskeleton organization GO:0007010 |
| 2 | P09972 | ALDOC | 0.5011 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q6P9H5 | GIMAP6 | 0.47669 | |
| 4 | Q5BVD1 | TTMP | 0.47654 | |
| 5 | Q9UBR1 | UPB1 | 0.4659 | |
| 6 | P42701 | IL12RB1 | 0.46481 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | Q5W0A0 | ERICH6B | 0.4645 | |
| 8 | P03372 | ESR1 | 0.45808 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 9 | Q16790 | CA9 | 0.44832 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q9BSF0 | C2orf88 | 0.44466 |
20 40 60 80 100 AA: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.DDDDD..D..D...............................D..DDD................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDD.DD.....D...........................DD.DDDDDDDDD...........................DDD.... DO_SPOTD: DDDDDDD.........................D....DD.D.DDD.DDDDDDDDDDDDDDDDDD.................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDD.................................DDDDDDDDDDD................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................... RICH_MOBI_[AG]: GyyvrprAApAGeGsrAGA RICH_MOBI_[AY]: YhgYYvrprAApAgegsrAgA RICH_MOBI_[A]: AApAgegsrAgA RICH_MOBI_[L]: LgeqrfgegLLpeeiLtptL RICH_MOBI_[EF]: EyEFanpsrlgEqrFgE RICH_MOBI_[EL]: LgEqrfgEgLLpEEiLtptL RICH_MOBI_[GY]: YhGYYvrpraapaGeGsraG RICH_MOBI_[LY]: LLpeeiLtptLYhgYY RICH_fLPS_MOBI_[Y]: fgegllpeeiltptlYhgYY
120 140 160 180 AA: ARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP STMI: DO_DISOPRED3: ..................................................................DDDDDDDDDDDDDDDD DO_IUPRED2A: D............................................DDDD.............DDDDDDD.DDDDDDDDDDDD DO_SPOTD: ...................................................D.DDD.........DDDDDDDDDDDDDDDDD CONSENSUS: .................................................................DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................DDDDDDDDDDDDDDDDD RICH_[E]: EEEEEaaivE RICH_[EP]: PaPPdPEEEE RICH_fLPS_[E]: EEEEEaaivE RICH_MOBI_[E]: EEEEEaaivE RICH_MOBI_[EP]: PaPPdPEEEE