Q9BSF0 SMAKA_HUMAN
Gene name: C2orf88
Protein name: Small membrane A-kinase anchor protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NFB2 | TMEM185A | 0.93191 | |
| 2 | Q07817 | BCL2L1 | 0.80314 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 3 | Q86XI2 | NCAPG2 | 0.80275 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 4 | P42857 | NSG1 | 0.80252 | cell death GO:0008219 cell-cell signaling GO:0007267 cellular component assembly GO:0022607 ... |
| 5 | Q6EKJ0 | GTF2IRD2B | 0.80214 | |
| 6 | Q86UP8 | GTF2IRD2 | 0.80214 | |
| 7 | Q9UI26 | IPO11 | 0.80081 | nucleocytoplasmic transport GO:0006913 protein transport GO:0015031 transport GO:0006810 |
| 8 | Q9BTA0 | FAM167B | 0.80012 | |
| 9 | Q8NEV9 | IL27 | 0.79926 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell population proliferation GO:0008283 ... |
| 10 | P55064 | AQP5 | 0.79823 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 ... |
20 40 60 80 AA: MGCMKSKQTFPFPTIYEGEKQHESEEPFMPEERCLPRMASPVNVKEEVKEPPGTNTVILEYAHRLSQDILCDALQQWACNNIKYHDIPYIESEGP STMI: DO_DISOPRED3: D...................................DDDDD....................................................DD DO_IUPRED2A: .............DDDDD.DDDDDDDDDDDDDD......DDDDDDDDDDDD.DD.D......................................D DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................DDDDD CONSENSUS: D............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................DD CONSENSUS_MOBI: ..............................................................................D................ RICH_[E]: EgEkqhEsEEpfmpEE RICH_[EP]: EsEEPfmPEErclPrmasP RICH_fLPS_[E]: tiyEgEkqhEsEEpfmpEEr