Q16558 KCMB1_HUMAN
Gene name: KCNMB1
Protein name: Calcium-activated potassium channel subunit beta-1
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- circulatory system process GO:0003013
- response to stress GO:0006950
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8TE54 | SLC26A7 | 0.82404 | transport GO:0006810 |
| 2 | O94955 | RHOBTB3 | 0.61396 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 3 | Q96BT1 | C3orf49 | 0.53916 | |
| 4 | Q8IYP9 | ZDHHC23 | 0.40726 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 protein targeting GO:0006605 ... |
| 5 | Q14168 | MPP2 | 0.39714 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 6 | Q3MJ13 | WDR72 | 0.39004 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 extracellular matrix organization GO:0030198 |
| 7 | Q96A28 | SLAMF9 | 0.37771 | |
| 8 | Q9P0W0 | IFNK | 0.3745 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | P62945 | RPL41 | 0.32822 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | Q9Y2L1 | DIS3 | 0.26968 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 nucleobase-containing compound catabolic process GO:0034655 ... |
20 40 60 80 100 AA: MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQN STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDD..DD.....DDD............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDD... ............................................................. CONSENSUS_MOBI: .................. ............................................................. RICH_[KM]: MvKKlvMaqK
120 140 160 180 AA: QQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..........................................................................................D DO_IUPRED2A: ........................................................................................... DO_SPOTD: .......................................................................................DDDD CONSENSUS: ......................................................... ............D CONSENSUS_MOBI: ......................................................... .............