Q9P0W0 IFNK_HUMAN
Gene name: IFNK
Protein name: Interferon kappa
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9BUL8 | PDCD10 | 0.58991 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
2 | Q8WVF2 | UCMA | 0.58619 | anatomical structure development GO:0048856 cell differentiation GO:0030154 embryo development GO:0009790 |
3 | Q8WWM9 | CYGB | 0.58513 | biosynthetic process GO:0009058 response to stress GO:0006950 small molecule metabolic process GO:0044281 ... |
4 | P20382 | PMCH | 0.54244 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
5 | Q9UIQ6 | LNPEP | 0.53396 | catabolic process GO:0009056 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
6 | Q9NY87 | SPANXC | 0.5002 | |
7 | Q9NS26 | SPANXA1 | 0.49388 | reproduction GO:0000003 |
8 | P56539 | CAV3 | 0.48685 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
9 | Q01629 | IFITM2 | 0.48685 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 ... |
10 | Q8TAF3 | WDR48 | 0.47783 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell population proliferation GO:0008283 ... |
20 40 60 80 100 AA: MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQ STMI: SSSSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDD...................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDD............................................................................................ CONSENSUS: ......................................................................... CONSENSUS_MOBI: .........................................................................
120 140 160 180 200 AA: HTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKF STMI: DO_DISOPRED3: ..........................................DD........................................................ DO_IUPRED2A: ..................................DDDDDDDDDDDDDDD................................................... DO_SPOTD: ...............................DDDDDDDDDDDDDDDDDDDDDD............................................... CONSENSUS: ..................................DDDDDDDDDDDDDDD................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[E]: EnEdmkEmkEnE RICH_[EM]: EnEdMkEMkEnEM RICH_[EN]: NEdmkEmkEN RICH_[KM]: MKeMKeneMK RICH_[MN]: NedMkeMkeN RICH_fLPS_[M]: dMkeMkeneM
AA: TALFRRK STMI: DO_DISOPRED3: ....... DO_IUPRED2A: ....... DO_SPOTD: .....DD CONSENSUS: ....... CONSENSUS_MOBI: .......