Q17RY6 LY6K_HUMAN
Gene name: LY6K
Protein name: Lymphocyte antigen 6K
List of terms from Generic GO subset, which this protein is a part of:
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15165 | PON2 | 0.85534 | catabolic process GO:0009056 response to stress GO:0006950 small molecule metabolic process GO:0044281 |
| 2 | O75881 | CYP7B1 | 0.7652 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 3 | P10915 | HAPLN1 | 0.75892 | anatomical structure development GO:0048856 cell adhesion GO:0007155 extracellular matrix organization GO:0030198 |
| 4 | P52798 | EFNA4 | 0.75844 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 5 | P24903 | CYP2F1 | 0.75489 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 6 | Q96SQ9 | CYP2S1 | 0.74016 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 7 | O43174 | CYP26A1 | 0.68826 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | P05186 | ALPL | 0.68033 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 9 | O14638 | ENPP3 | 0.65455 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 10 | P45877 | PPIC | 0.65128 | cellular protein modification process GO:0006464 protein folding GO:0006457 |
20 40 60 80 100 AA: MALLALLLVVALPRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVAKQCSAGCAAMERPKPEEK STMI: SSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDD.....D.....DDDDDDDDDDD................................................................... DO_IUPRED2A: ......................DDDDDDDDDD.................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................D.... CONSENSUS: .....DDDDDDDDDDD................................................................... CONSENSUS_MOBI: ...................................................................................
120 140 160 AA: RFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSMGESCGGLWLAILLLLASIAAGLSLS STMI: DO_DISOPRED3: .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ................................................................. DO_SPOTD: ....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................................................................. RICH_[AI]: AIllllAsIAA RICH_[AL]: LwLAiLLLLAsiAAgLsL RICH_[L]: LwLaiLLLLasiaagLsL RICH_[GL]: GsmGescGGLwLaiLLLL RICH_[IL]: LwLaILLLLasIaagLsL RICH_fLPS_[L]: ggLwLaiLLLLasiaagLsL