Q30KQ4 DB116_HUMAN

Gene name: DEFB116
Protein name: Beta-defensin 116

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NZU0 FLRT3 0.6729 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
2 Q92765 FRZB 0.64578 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
3 Q59H18 TNNI3K 0.61857 cellular protein modification process GO:0006464
circulatory system process GO:0003013
4 Q96Q07 BTBD9 0.60191 cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
5 Q6QHK4 FIGLA 0.59142 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 C9JLW8 MCRIP1 0.57697 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 Q9HAK2 EBF2 0.57619 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q16620 NTRK2 0.57142 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q9UGV2 NDRG3 0.56967 cell differentiation GO:0030154
growth GO:0040007
reproduction GO:0000003
...
10 Q8N961 ABTB2 0.56783

                                           20                  40                  60                  80                 100
AA:                      MSVMKPCLMTIAILMILAQKTPGGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYS
STMI:                    SSSSSSSSSSSSSSSSSSSSSSS                                                                             
DO_DISOPRED3:            DD.....DD............................................................................DDDDDDDDDDDDDDD
DO_IUPRED2A:             ...........................DD.......................................................................
DO_SPOTD:                DDD.......................DDDDDDD............................................DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                      ....DD........................................................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                 ...........................................................DDDDDDDDDDDDDDDDDD
RICH_[S]:                                                                                                      SnSnlSvtnSSSyS
RICH_[NS]:                                                                                                     SNSNlSvtNSSSyS
RICH_fLPS_[S]:                                                                                                dSnSnlSvtnSSSyS
RICH_MOBI_[S]:                                                                                                 SnSnlSvtnSSSyS
RICH_MOBI_[Y]:                                                                                               YdsnsnlsvtnsssY 
RICH_MOBI_[SY]:                                                                                              YdSnSnlSvtnSSSYS
RICH_MOBI_[NS]:                                                                                                SNSNlSvtNSSSyS
RICH_MOBI_[NY]:                                                                                              YdsNsNlsvtNsssY 

                                           
AA:                      HI
STMI:                      
DO_DISOPRED3:            DD
DO_IUPRED2A:             ..
DO_SPOTD:                DD
CONSENSUS:               DD
CONSENSUS_MOBI:          DD