Q3LI81 KR271_HUMAN
Gene name: KRTAP27-1
Protein name: Keratin-associated protein 27-1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P60372 | KRTAP10-4 | 0.87299 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 2 | P60411 | KRTAP10-9 | 0.76263 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 3 | P60371 | KRTAP10-6 | 0.69363 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 4 | Q14525 | KRT33B | 0.66632 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 5 | A8MX34 | KRTAP29-1 | 0.62749 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | Q6UXN8 | CLEC9A | 0.62379 | cell-cell signaling GO:0007267 protein transport GO:0015031 transport GO:0006810 ... |
| 7 | Q9HBK9 | AS3MT | 0.62268 | small molecule metabolic process GO:0044281 |
| 8 | O76011 | KRT34 | 0.60432 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 9 | Q9Y4K3 | TRAF6 | 0.60128 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | O76009 | KRT33A | 0.59623 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MPHSHCHSLRSFHNAPPLSAITHGTNPITFEDRLCLPSSFHSRTCFLDNFQETCNETTSCQMTNCEQDLFTDDSCVQSNCFPGVVQTTYSNSRPCERTAC STMI: DO_DISOPRED3: DDDDDDDDD.................................................D...DDDDD.D..........................D.D.. DO_IUPRED2A: ......................DD............................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDD.............DD..................................DDDDDDDDDDD..........................DDDDD CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: QSESSSAGLACVSQPCQSESTQQMGFVAQSCQPASLKGNSCPPKTSKSKNFETLERASSQCQCQSQNPESSSCRPLVNVAPEPQLLESSPGVEPTCCVTG STMI: DO_DISOPRED3: D.D.DD.D.D.D.........................................D....D.DDDD.DDDDDDDDDDDDDDDDD.................. DO_IUPRED2A: .........................................................................DD........DD............... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDD.........................................D....DDDDDDDDDDDDDDDDDDDDDDDDDDD............... CONSENSUS_MOBI: ...................................................................................DDDDDDDDDDDDDDDDD RICH_[QS]: SQcQcQSQnpeSSS RICH_[C]: CqCqsqnpesssC RICH_[CQ]: QCQCQsQnpesssC RICH_[CS]: SqCqCqSqnpeSSSC RICH_fLPS_[C]: sqCqCqsqnpesssC
AA: GSQLPSK STMI: DO_DISOPRED3: ....DDD DO_IUPRED2A: ....... DO_SPOTD: DDDDDDD CONSENSUS: ....DDD CONSENSUS_MOBI: DDDDDDD