Q6UXN8 CLC9A_HUMAN
Gene name: CLEC9A
Protein name: C-type lectin domain family 9 member A
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9HBK9 | AS3MT | 0.99388 | small molecule metabolic process GO:0044281 |
| 2 | P60409 | KRTAP10-7 | 0.89324 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 3 | Q96GX9 | APIP | 0.89238 | biosynthetic process GO:0009058 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 4 | Q9H4E5 | RHOJ | 0.88001 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell morphogenesis GO:0000902 ... |
| 5 | Q14525 | KRT33B | 0.87816 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 6 | P60371 | KRTAP10-6 | 0.83829 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 7 | P60411 | KRTAP10-9 | 0.8115 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 8 | Q96Q40 | CDK15 | 0.79731 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | A8MX34 | KRTAP29-1 | 0.79698 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | Q9UC07 | ZNF69 | 0.78087 |
20 40 60 80 100 AA: MHEEEIYTSLQWDSPAPDTYQKCLSSNKCSGACCLVMVISCVFCMGLLTASIFLGVKLLQVSTIAMQQQEKLIQQERALLNFTEWKRSCALQMKYCQAFM STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDD.....DDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD.......................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD...........DDDDDDD...DDDDDDDDD.................................................................. CONSENSUS: DDD............DDDDDDDDDDDDDDDDDDD. ............................................ CONSENSUS_MOBI: ................................... ............................................ RICH_[C]: ClssnkCsgaCC RICH_fLPS_[C]: yqkClssnkCsgaCC
120 140 160 180 200 AA: QNSLSSAHNSSPCPNNWIQNRESCYYVSEIWSIWHTSQENCLKEGSTLLQIESKEEMDFITGSLRKIKGSYDYWVGLSQDGHSGRWLWQDGSSPSPGLLP STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..................................................................................................DD DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: .........D..........................................................................................
220 240 AA: AERSQSANQVCGYVKSNSLLSSNCSTWKYFICEKYALRSSV STMI: DO_DISOPRED3: ......................................DDD DO_IUPRED2A: ......................................... DO_SPOTD: .....................................DDDD CONSENSUS: ......................................DDD CONSENSUS_MOBI: ..DDDDD..............................DDDD