Q3Y452 TDRG1_HUMAN
Gene name: TDRG1
Protein name: Testis development-related protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96HJ9 | FMC1 | 0.87646 | |
| 2 | Q96PH1 | NOX5 | 0.67427 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 3 | Q0IIM8 | TBC1D8B | 0.66465 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 4 | Q14314 | FGL2 | 0.65327 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q86UP0 | CDH24 | 0.60941 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 6 | Q9GZP9 | DERL2 | 0.57208 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 7 | A6NDR6 | MEIS3P1 | 0.55947 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 8 | Q99611 | SEPHS2 | 0.555 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 |
| 9 | Q8IUH3 | RBM45 | 0.52616 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 10 | Q9BZA7 | PCDH11X | 0.52589 | cell adhesion GO:0007155 |
20 40 60 80 AA: MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL STMI: DO_DISOPRED3: D..................................................................................................D DO_IUPRED2A: ...........D......DDD.DDDDDD..........................D..DDDDDDDDD......DDD...........D.D........... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: D..........D......DDDDDDDDDD..........................DDDDDDDDDDDD......DDD...........DDD..........D CONSENSUS_MOBI: ........................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[G]: GlGslGGqdssG RICH_MOBI_[GL]: GLGsLGGqdssGsL RICH_MOBI_[GS]: SlGGqdSSGS