Q96HJ9 FMC1_HUMAN

Gene name: FMC1
Protein name: Protein FMC1 homolog

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q3Y452 TDRG1 0.87646 anatomical structure development GO:0048856
2 Q14314 FGL2 0.76497 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
3 Q9GZP9 DERL2 0.70711 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cell population proliferation GO:0008283
...
4 Q8N9L7 n/a 0.70711
5 Q99611 SEPHS2 0.68599 biosynthetic process GO:0009058
small molecule metabolic process GO:0044281
6 Q8IUH3 RBM45 0.65035 anatomical structure development GO:0048856
cell differentiation GO:0030154
7 Q6ZRV3 LINC00696 0.6231
8 A2IDD5 CCDC78 0.62289 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
9 Q8N1Y9 n/a 0.61874
10 A8MV23 SERPINE3 0.60948

                                           20                  40                  60                  80                 100
AA:                      MAALGSPSHTFRGLLRELRYLSAATGRPYRDTAAYRYLVKAFRAHRVTSEKLCRAQHELHFQAATYLCLLRSIRKHVALHQEFHGKGERSVEESAGLVGL
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDD.............................................................................................
DO_IUPRED2A:             ...................................................................................D................
DO_SPOTD:                DDDDD...............................................................................................
CONSENSUS:               DDDDD...............................................................................................
CONSENSUS_MOBI:          .............................................................................................DDDDDDD
RICH_MOBI_[G]:                                                                                                          GlvGl
RICH_MOBI_[GL]:                                                                                                         GLvGL

                                
AA:                      KLPHQPGGKGWEP
STMI:                                 
DO_DISOPRED3:            ........DDDDD
DO_IUPRED2A:             ........DDDDD
DO_SPOTD:                ....DDDDDDDDD
CONSENSUS:               ........DDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDD
RICH_MOBI_[G]:           klphqpGGkG   
RICH_MOBI_[GL]:          kLphqpGGkG