Q3ZCW2 LEGL_HUMAN
Gene name: LGALSL
Protein name: Galectin-related protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8WVY7 | UBLCP1 | 0.7413 | cellular protein modification process GO:0006464 |
| 2 | P52434 | POLR2H | 0.67116 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q9Y6J8 | STYXL1 | 0.67116 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 4 | Q8N1C3 | GABRG1 | 0.65812 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | Q8NE00 | TMEM104 | 0.61292 | |
| 6 | O75794 | CDC123 | 0.60947 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell division GO:0051301 ... |
| 7 | P32121 | ARRB2 | 0.57941 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q6NVV0 | MKRN9P | 0.56574 | |
| 9 | Q9UBS8 | RNF14 | 0.55272 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q8NG06 | TRIM58 | 0.55243 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[D]: DsDavvklDD RICH_[DV]: VaDsDaVVklDD RICH_[LN]: LddghLNNsL RICH_fLPS_[D]: DsDavvklDD
120 140 160 AA: CISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLG STMI: DO_DISOPRED3: ........................................................................ DO_IUPRED2A: ........................................................................ DO_SPOTD: ........................................................................ CONSENSUS: ........................................................................ CONSENSUS_MOBI: ........................................................................