Q4G0G2 H1AS1_HUMAN
Gene name: H1-10-AS1
Protein name: Putative uncharacterized protein H1-10-AS1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9HAV7 | GRPEL1 | 0.5977 | protein folding GO:0006457 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 2 | Q5SSQ6 | SAPCD1 | 0.58652 | |
| 3 | Q9UGC6 | RGS17 | 0.58491 | signal transduction GO:0007165 |
| 4 | Q99541 | PLIN2 | 0.57411 | transport GO:0006810 |
| 5 | Q15436 | SEC23A | 0.57038 | cellular component assembly GO:0022607 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 6 | Q16610 | ECM1 | 0.56846 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 7 | Q5W0B7 | TMEM236 | 0.55888 | |
| 8 | Q6IN84 | MRM1 | 0.55358 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 9 | O43908 | KLRC4 | 0.55252 | |
| 10 | Q96PG2 | MS4A10 | 0.54189 |
20 40 60 80 AA: MGWEQETQKSRPWNQVEGRQPGHDPEQDTCSTSPFAMSKSSLRPPKKLMPCASCTAAEPDGFPWLCYSHSWKCCLTESSGHPGRMDVVYPLLYRWGN STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD.D..D..........D................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................... RICH_[QW]: WeQetQksrpWnQvegrQ RICH_[Q]: QetQksrpwnQvegrQ RICH_[W]: WeqetqksrpW RICH_MOBI_[QW]: WeQetQksrpWnQvegrQ RICH_MOBI_[Q]: QetQksrpwnQvegrQ RICH_MOBI_[W]: WeqetqksrpW