Q4G0N7 F229B_HUMAN

Gene name: FAM229B
Protein name: Protein FAM229B

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15375 EPHA7 0.76053 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
2 O60602 TLR5 0.74503 cell-cell signaling GO:0007267
immune system process GO:0002376
protein transport GO:0015031
...
3 Q8N1H7 SIX6OS1 0.62765 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
4 Q9H1P3 OSBPL2 0.5741 biosynthetic process GO:0009058
cellular component assembly GO:0022607
membrane organization GO:0061024
...
5 Q9UBC2 EPS15L1 0.56318 membrane organization GO:0061024
signal transduction GO:0007165
transport GO:0006810
...
6 O43173 ST8SIA3 0.50925
7 A2RUQ5 C17orf102 0.49833
8 Q9Y592 CEP83 0.48822 cellular component assembly GO:0022607
transport GO:0006810
vesicle-mediated transport GO:0016192
9 Q9UJ37 ST6GALNAC2 0.48688 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
10 P14384 CPM 0.48146 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
protein maturation GO:0051604

                                           20                  40                  60                  80                    
AA:                      MPFQFGTQPRRFPVEGGDSSIELEPGLSSSAACNGKEMSPTRQLRRCPGSHCLTITDVPVTVYATTRKPPAQSSKEMHPK
STMI:                                                                                                    
DO_DISOPRED3:            DDDDDDDD..............DDDDDDDDDDDDD....................................DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................
RICH_[F]:                  FqFgtqprrF                                                                    
RICH_MOBI_[F]:             FqFgtqprrF                                                                    
RICH_fLPS_MOBI_[F]:      mpFqFgtqprrFpve