A2RUQ5 CQ102_HUMAN
Gene name: C17orf102
Protein name: Uncharacterized protein C17orf102
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q49B96 | COX19 | 0.69892 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 |
| 2 | Q15375 | EPHA7 | 0.65524 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 3 | Q9Y592 | CEP83 | 0.57354 | cellular component assembly GO:0022607 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 4 | Q4G0N7 | FAM229B | 0.49833 | |
| 5 | Q9UK32 | RPS6KA6 | 0.43381 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 embryo development GO:0009790 ... |
| 6 | Q9UJ37 | ST6GALNAC2 | 0.41947 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 7 | O60602 | TLR5 | 0.39568 | cell-cell signaling GO:0007267 immune system process GO:0002376 protein transport GO:0015031 ... |
| 8 | Q86XK3 | SFR1 | 0.38752 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 9 | Q8N1H7 | SIX6OS1 | 0.35592 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 10 | C9J7I0 | UMAD1 | 0.34488 |
20 40 60 80 100 AA: MFDFSFPTPASAGTRMGPASCGGRSLHLPQLRFSRVDATAVTDVPFQRMHAPHRAPEVFCSRSSRGAGRGHPTPTPRVRWALAGNQPRCCAQLLSGRGGS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .......D.D..DDDDDDDD.D.....................DDDDD........DDDDDDDDDDDDDDDDDDDDDDDD.................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDDDDDDD............................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.....................DDDDD.............DDDDDDDDDD............................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................................... RICH_fLPS_[F]: mFdFsFptpa RICH_MOBI_[FM]: MFdFsFptpasagtrM RICH_fLPS_MOBI_[F]: mFdFsFptpasagtr
120 140 160 AA: GAQLRAGWVRGAAVGNLFILLLGKEDGEEEGTVLSYSSMVHISNITGIVGTTVSRTKPALVLMELTF STMI: DO_DISOPRED3: ................................................................... DO_IUPRED2A: ................................................................... DO_SPOTD: ................................................................... CONSENSUS: ................................................................... CONSENSUS_MOBI: ...................................................................