Q4W5N1 ABCAB_HUMAN
Gene name: ABCA11P
Protein name: Putative ATP-binding cassette sub-family A member 11
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NZJ6 | COQ3 | 0.82209 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 2 | Q9UPT9 | USP22 | 0.79602 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | Q8WTS1 | ABHD5 | 0.77407 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 4 | O43681 | GET3 | 0.7485 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 5 | Q92752 | TNR | 0.73497 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 6 | Q8N6S4 | ANKRD13C | 0.73093 | biosynthetic process GO:0009058 cell death GO:0008219 |
| 7 | Q9NY72 | SCN3B | 0.7088 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 circulatory system process GO:0003013 ... |
| 8 | Q9H5V9 | CXorf56 | 0.7088 | |
| 9 | Q9NX24 | NHP2 | 0.7088 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 10 | P07951 | TPM2 | 0.70494 | cytoskeleton organization GO:0007010 |
20 40 60 80 100 AA: MKYGNEIMNKDPVFRISPRSRGTHTNPEEPEEDVQAERVQAANALTTPNLEEEPVITASCLHKEYYETKKVAFQQQRRKQPSEMFRFVLKSEVLGLLGHN STMI: DO_DISOPRED3: DD....................DDDDDDDDDD.................................................................... DO_IUPRED2A: DDD.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................DDD.DD....................... DO_SPOTD: DDDDDDDD.........DDDDDDDDDDD....D...DDDDDDDDDD...................................................... CONSENSUS: DDD..............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. RICH_[AE]: EEpEEdvqAErvqAAnA RICH_[E]: EEpEEdvqaE RICH_MOBI_[IM]: MkygneIMnkdpvfrI
120 140 AA: GAGKSTSIKMITGCTVPTAGVVVLQGNRASVRQQRDNSLKFLGTALRRTHCVPNLQ STMI: DO_DISOPRED3: ........................................................ DO_IUPRED2A: .......DDD................DD............................ DO_SPOTD: ........................................................ CONSENSUS: ........................................................ CONSENSUS_MOBI: ........................................................