Q9NX24 NHP2_HUMAN
Gene name: NHP2
Protein name: H/ACA ribonucleoprotein complex subunit 2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- DNA metabolic process GO:0006259
- homeostatic process GO:0042592
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q02790 | FKBP4 | 0.94868 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 2 | Q8IWX7 | UNC45B | 0.89443 | anatomical structure development GO:0048856 cell differentiation GO:0030154 protein folding GO:0006457 |
| 3 | Q9NZJ6 | COQ3 | 0.87416 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 4 | O43681 | GET3 | 0.79035 | membrane organization GO:0061024 protein targeting GO:0006605 protein transport GO:0015031 ... |
| 5 | Q149M9 | NWD1 | 0.78935 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | P11055 | MYH3 | 0.75425 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 7 | Q9BPX5 | ARPC5L | 0.73994 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 8 | Q9H0Q3 | FXYD6 | 0.72726 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 9 | Q8N6S4 | ANKRD13C | 0.71554 | biosynthetic process GO:0009058 cell death GO:0008219 |
| 10 | Q4W5N1 | ABCA11P | 0.7088 |
20 40 60 80 100 AA: MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQIRRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCED STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD....D......................................................................... DO_IUPRED2A: DDDDDDD.DDDDD.DDD................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AE]: EAqAEAcsgE
120 140 AA: RNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL STMI: DO_DISOPRED3: ..................................................... DO_IUPRED2A: ..................................................... DO_SPOTD: ...................................................DD CONSENSUS: ..................................................... CONSENSUS_MOBI: .....................................................