Q5BJH2 TM128_HUMAN

Gene name: TMEM128
Protein name: Transmembrane protein 128

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H270 VPS11 0.77613 catabolic process GO:0009056
cellular component assembly GO:0022607
membrane organization GO:0061024
...
2 Q8IYM2 SLFN12 0.75615
3 O43286 B4GALT5 0.75615 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
4 Q96RP7 GAL3ST4 0.75499 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell-cell signaling GO:0007267
5 Q8NB49 ATP11C 0.75414 anatomical structure development GO:0048856
cell differentiation GO:0030154
immune system process GO:0002376
...
6 Q96EY5 MVB12A 0.75305 biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
cellular component assembly GO:0022607
...
7 Q6TFL4 KLHL24 0.75305 cellular protein modification process GO:0006464
cytoskeleton organization GO:0007010
signal transduction GO:0007165
...
8 Q8WW59 SPRYD4 0.74516
9 Q495T6 MMEL1 0.71291
10 P52823 STC1 0.71012 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...

                                           20                  40                  60                  80                 100
AA:                      MDSSRARQQLRRRFLLLPDAEAQLDREGDAGPETSTAVEKKEKPLPRLNIHSGFWILASIVVTYYVDFFKTLKENFHTSSWFLCGSALLLVSLSIAFYCI
STMI:                                                                    MMMMMMMMMMMMMMMMMMMMM           MMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDD.D.DDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................
DO_IUPRED2A:             ..........................DDDDDDDDDDD...............................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......                     ...........                    
CONSENSUS_MOBI:          ................................................                     ...........                    
RICH_[AE]:                                  AEAqldrEgdAgpEtstAvE                                                             
RICH_[L]:                         LrrrfLLLpdaeaqL                                                                            
RICH_[R]:                    RaRqqlRRRflllpdaeaqldR                                                                          
RICH_[LR]:                   RaRqqLRRRfLLLpdaeaqLdR                                                                          
RICH_fLPS_[R]:              sRaRqqlRRR                                                                                       

                                          120                 140                 160               
AA:                      VYLEWYCGIGEYDVKYPALIPITTASFIAAGICFNIALWHVWSFFTPLLLFTQFMGVVMFITLLG
STMI:                    M                 MMMMMMMMMMMMMMMMMMMMM    MMMMMMMMMMMMMMMMMMMMM 
DO_DISOPRED3:            .................................................................
DO_IUPRED2A:             .................................................................
DO_SPOTD:                ............................................................DDDDD
CONSENSUS:                .................                     ....                     .
CONSENSUS_MOBI:           .................                     ....                     .