Q5BKU9 OXLD1_HUMAN

Gene name: OXLD1
Protein name: Oxidoreductase-like domain-containing protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96T55 KCNK16 0.66253 transmembrane transport GO:0055085
transport GO:0006810
2 P62917 RPL8 0.64443 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q14624 ITIH4 0.61806 response to stress GO:0006950
small molecule metabolic process GO:0044281
transport GO:0006810
...
4 Q8WY22 BRI3BP 0.60705
5 Q03113 GNA12 0.60524 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
6 Q8NEG7 DENND6B 0.59594
7 Q8TBK2 SETD6 0.57499 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular nitrogen compound metabolic process GO:0034641
...
8 Q6ZRI8 ARHGAP36 0.55906 signal transduction GO:0007165
9 Q9BYL1 SAMD10 0.55714
10 Q8N7L0 FAM216B 0.5441

                                           20                  40                  60                  80                 100
AA:                      MLLRRVVEGGRAVAAAVRGSGARRFSSPDCCQRLPGGGSFLQRHHPGAQAPDGRRKFGTDHVEVGSQAGADGTRPPKASLPPELQPPTNCCMSGCPNCVW
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD..DD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................
DO_IUPRED2A:             .............D...DD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
CONSENSUS_MOBI:          ...................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................
RICH_[AG]:                       GGrAvAAAvrGsGA                                                                              
RICH_[AR]:                  RRvveggRAvAAAvRgsgARR                                                                            
RICH_[AV]:                    VVeggrAVAAAVrgsgA                                                                              
RICH_[A]:                           AvAAAvrgsgA                                                                              
RICH_[RV]:                  RRVVeggRaVaaaVRgsgaRR                                                                            
RICH_[R]:                   RRvveggRavaaavRgsgaRR                                                                            
RICH_[V]:                     VVeggraVaaaV                                                                                   
RICH_[GH]:                                                  GGGsflqrHH                                                       
RICH_[GR]:                  RRvveGGRavaaavRGsGaRR                                                                            
RICH_[GV]:                    VVeGGraVaaaVrGsG                                                                               
RICH_MOBI_[GH]:                                             GGGsflqrHH                                                       

                                          120                 140             
AA:                      VEYADRLLQHFQDGGERALAALEEHVADENLKAFLRMEIRLHTRCGG
STMI:                                                                   
DO_DISOPRED3:            ............................................DDD
DO_IUPRED2A:             ..................DD.DD........................
DO_SPOTD:                ...........................................DDDD
CONSENSUS:               ............................................DDD
CONSENSUS_MOBI:          ...............................................