Q5I0X4 CF226_HUMAN

Gene name: C6orf226
Protein name: Uncharacterized protein C6orf226

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q4LDE5 SVEP1 0.89731 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell junction organization GO:0034330
...
2 Q99999 GAL3ST1 0.86833 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
3 Q5H8A4 PIGG 0.86169 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
4 P41273 TNFSF9 0.85816 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
5 P56746 CLDN15 0.85629 cell adhesion GO:0007155
cell junction organization GO:0034330
cellular component assembly GO:0022607
...
6 Q8WZ71 TMEM158 0.85548
7 Q96L94 SNX22 0.84845 protein transport GO:0015031
transport GO:0006810
8 P51606 RENBP 0.84271 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
9 Q8NBI6 XXYLT1 0.8149 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
10 Q93097 WNT2B 0.7924 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MERPRSPQCSAPASASASVTLAQLLQLVQQGQELPGLEKRHIAAIHGEPTASRLPRRPKPWEAAALAESLPPPTLRIGTAPAEPGLVEAATAPSSWHTVG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDD......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDD.....DD..D...DDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD.....DD......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AI]:                                                        IAAIhgeptA                                                 
RICH_[AP]:                                                               PtAsrlPrrPkPweAAAlA   PPPtlrigtAPAePglveAA          
RICH_[A]:                                                                              AAAlAeslppptlrigtApAepglveAAtA        
RICH_[P]:                                                                      PrrPkPweaaalaeslPPP                           
RICH_[R]:                                                       RhiaaihgeptasRlpRR                                           

                                            
AA:                      P
STMI:                     
DO_DISOPRED3:            D
DO_IUPRED2A:             D
DO_SPOTD:                D
CONSENSUS:               D
CONSENSUS_MOBI:          .