Q96L94 SNX22_HUMAN
Gene name: SNX22
Protein name: Sorting nexin-22
List of terms from Generic GO subset, which this protein is a part of:
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P41273 | TNFSF9 | 0.98843 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 2 | Q4LDE5 | SVEP1 | 0.98644 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 3 | P51606 | RENBP | 0.86716 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | O75147 | OBSL1 | 0.85861 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
| 5 | Q8N5N4 | C3orf22 | 0.85661 | |
| 6 | Q5I0X4 | C6orf226 | 0.84845 | |
| 7 | Q69YG0 | TMEM42 | 0.83189 | |
| 8 | Q53RT3 | ASPRV1 | 0.81236 | anatomical structure development GO:0048856 protein maturation GO:0051604 |
| 9 | Q8NBI6 | XXYLT1 | 0.81038 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 10 | Q8WZ71 | TMEM158 | 0.80796 |
20 40 60 80 100 AA: MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRGLEQRRQGLEAYIQGILYLNQEVPKE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .......DDDDDDDDDDDDDD.................................................DD.DD......................... DO_SPOTD: ............DDDDDDDD................................................................................ CONSENSUS: ............DDDDDDDD................................................................................ CONSENSUS_MOBI: D...................................................................................................
120 140 160 180 AA: LLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVLSFHVDPYVCNPSPESLPNVVVNGVLQGLYSFSISPDKAQPKAACHPAPLPPMP STMI: DO_DISOPRED3: ...............DDDDDDDDDDDDDD...............................................DDDDDDDDDDDDDDDDD DO_IUPRED2A: ....................DDDD.DDD.DD....DD...........................................DDDDDDDDDDDDD DO_SPOTD: ...........DDDDDDDDDDDDDDDDDDDDDD........................................DDDDDDDDDDDDDDDDDDDD CONSENSUS: ...............DDDDDDDDDDDDDDDD.............................................DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................................................. RICH_[AP]: AAchPAPlPP RICH_[A]: AqpkAAchpA RICH_[P]: PkaachPaPlPPmP