Q5J5C9 DB121_HUMAN
Gene name: DEFB121
Protein name: Beta-defensin 121
List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14829 | PPEF1 | 0.88492 | cellular protein modification process GO:0006464 nervous system process GO:0050877 signal transduction GO:0007165 |
| 2 | P30411 | BDKRB2 | 0.87416 | cell death GO:0008219 cellular protein modification process GO:0006464 circulatory system process GO:0003013 ... |
| 3 | P47211 | GALR1 | 0.86193 | biosynthetic process GO:0009058 cell-cell signaling GO:0007267 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | P17035 | ZNF28 | 0.85138 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | O94941 | UBOX5 | 0.82035 | cellular protein modification process GO:0006464 |
| 6 | Q9H3Z4 | DNAJC5 | 0.81373 | cell death GO:0008219 cell-cell signaling GO:0007267 immune system process GO:0002376 ... |
| 7 | A9QM74 | KPNA7 | 0.80218 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cellular protein modification process GO:0006464 ... |
| 8 | A0A0U1RQI7 | KLF18 | 0.79184 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q9H5Y7 | SLITRK6 | 0.78347 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
| 10 | P20138 | CD33 | 0.77074 | cell adhesion GO:0007155 cell population proliferation GO:0008283 cell-cell signaling GO:0007267 ... |
20 40 60 AA: MKLLLLLLTVTLLLAQVTPVMKCWGKSGRCRTTCKESEVYYILCKTEAKCCVDPKYVPVKPKLTDTNTSLESTSAV STMI: SSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDD................................................DDDDDDDDDDDDD DO_IUPRED2A: ............................................................................ DO_SPOTD: DDDDDDDDDDDDDDD...........................................DDDDDDDDDDDDDDDDDD CONSENSUS: ................................................DDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................. RICH_[T]: TdTnTslesT