Q9H3Z4 DNJC5_HUMAN
Gene name: DNAJC5
Protein name: DnaJ homolog subfamily C member 5
List of terms from Generic GO subset, which this protein is a part of:
- cell death GO:0008219
- cell-cell signaling GO:0007267
- immune system process GO:0002376
- protein folding GO:0006457
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96IY1 | NSL1 | 0.94433 | cell cycle GO:0007049 cell division GO:0051301 chromosome organization GO:0051276 ... |
| 2 | P39086 | GRIK1 | 0.94281 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 3 | A0A0U1RQI7 | KLF18 | 0.89333 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | O43586 | PSTPIP1 | 0.88729 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 ... |
| 5 | Q7Z5S9 | TMEM144 | 0.87916 | |
| 6 | Q5T9L3 | WLS | 0.86913 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell-cell signaling GO:0007267 ... |
| 7 | P43121 | MCAM | 0.8442 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 8 | Q9BY67 | CADM1 | 0.83668 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 ... |
| 9 | Q96LB1 | MRGPRX2 | 0.82975 | cell cycle GO:0007049 cell division GO:0051301 immune system process GO:0002376 ... |
| 10 | Q9UKJ0 | PILRB | 0.81373 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFV STMI: DO_DISOPRED3: DDDDDDDDDD.......................................................................................... DO_IUPRED2A: DDDDDD..............................................DD.............................................. DO_SPOTD: DDDDDDDDDDDDD....................................................................................... CONSENSUS: DDDDDDDDDD.......................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: LSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKAPEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN STMI: DO_DISOPRED3: ....................................................DDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..............................................DD...........DDD.......DDDD......................... DO_SPOTD: ..............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ..............................................DD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................. RICH_[T]: TdTpiviqpasaTeTTqlTadshpsyhT RICH_fLPS_[T]: aTdTpiviqpasaTeTTqlT