Q5JQS6 GSAML_HUMAN

Gene name: GCSAML
Protein name: Germinal center-associated signaling and motility-like protein

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P0DMP2 SRGAP2B 0.67112 anatomical structure development GO:0048856
2 A0A1B0GTZ2 CCDC196 0.668
3 P0DJJ0 SRGAP2C 0.66754 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
4 Q6ZXV5 TMTC3 0.66364 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
5 Q7Z5D8 NANOGNB 0.64099
6 A0A024R1R8 hCG_2014768 0.63986 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
7 Q14141 SEPTIN6 0.63705 biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
cell differentiation GO:0030154
...
8 Q9UNY4 TTF2 0.63534 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
9 Q9BXJ9 NAA15 0.634 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 Q9H875 PRKRIP1 0.63178 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
mRNA processing GO:0006397

                                           20                  40                  60                  80                 100
AA:                      MGNYLLRKLSCLGENQKKPKKGNPDEERKRQEMTTFERKLQDQDKKSQEVSSTSNQENENGSGSEEVCYTVINHIPHQRSSLSSNDDGYENIDSLTRKVR
STMI:                                                                                                                        
DO_DISOPRED3:            DDD...........................................DDDDDDDDDDDD..DD......................................
DO_IUPRED2A:             ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDD.....DDDDDDD
CONSENSUS:               DDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDD.....DDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................
RICH_[K]:                                KKpKKgnpdeerK                                                                       
RICH_[Q]:                                              QemttferklQdQdkksQ                                                    
RICH_[EK]:                            EnqKKpKKgnpdEErKrqE                                                                    
RICH_[KQ]:                                           KrQemttferKlQdQdKKsQ                                                    
RICH_MOBI_[E]:                                                                   EnEngsgsEE                                  
RICH_MOBI_[K]:                  KlsclgenqKKpKKgnpdeerK                                                                       
RICH_MOBI_[Q]:                                         QemttferklQdQdkksQ                                                    
RICH_MOBI_[EK]:                       EnqKKpKKgnpdEErKrqE                                                                    
RICH_MOBI_[EN]:                                                                  ENENgsgsEE                                  
RICH_MOBI_[ES]:                                                        SqEvSStSnqEnEngSgSEE                                  
RICH_MOBI_[KL]:              LLrKLscLgenqKKpKK                                                                               
RICH_MOBI_[KQ]:                                      KrQemttferKlQdQdKKsQ                                                    
RICH_MOBI_[NS]:                                                            SStSNqeNeNgSgS                                    

                                          120     
AA:                      QFRERSETEYALLRTSVSRPCSCTHEHDYEVVFPH
STMI:                                                       
DO_DISOPRED3:            ...................................
DO_IUPRED2A:             D.D..DDDDD.......................DD
DO_SPOTD:                DDDDDDDD.........DDDDD.D...........
CONSENSUS:               DDDDDDDD...........................
CONSENSUS_MOBI:          ...................................