Q5K130 CLU1O_HUMAN

Gene name: CLLU1-AS1
Protein name: Putative uncharacterized protein CLLU1-AS1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96PP4 TSGA13 0.86614
2 Q9H3H1 TRIT1 0.86205 cellular nitrogen compound metabolic process GO:0034641
3 Q4W5G0 TIGD2 0.85358
4 Q9HAN9 NMNAT1 0.84716 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
5 O96001 PPP1R17 0.84463 anatomical structure development GO:0048856
signal transduction GO:0007165
6 Q15650 TRIP4 0.83476 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 A6NCN8 TEX52 0.8248
8 Q8WV22 NSMCE1 0.82213 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
...
9 Q13772 NCOA4 0.82012 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
10 Q6ZNX1 SHLD3 0.8182 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...

                                           20                  40                  60                  80                 100
AA:                      MNKLGHNELKECLKTATDSLQTVQPSISQTCTSYGPALGAPLPGRNEVALLTSLPPNYEISEGKPRAISAYVRAGKGNVTRRRKKTHLGNDDGKKEAQEK
STMI:                                                                                                                        
DO_DISOPRED3:            DDD...................................................................................DDDDDDDD.DDDDD
DO_IUPRED2A:             DD..D.DDDDDDDDDDDDDD..DDDDDDD.DDDDDDDDDD.DD.DDDDDDDDDDDDD.DDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDD.......DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDD........DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[K]:                                                                                           KgnvtrrrKKthlgnddgKKeaqeK
RICH_[T]:                                TdslqTvqpsisqTcT                                                                    
RICH_[GK]:                                                                                         GKGnvtrrrKKthlGnddGK      
RICH_[KR]:                                                                                          KgnvtRRRKK               
RICH_MOBI_[K]:                                                                                      KgnvtrrrKKthlgnddgKKeaqeK
RICH_MOBI_[KR]:                                                                                     KgnvtRRRKK               

                                            
AA:                      M
STMI:                     
DO_DISOPRED3:            D
DO_IUPRED2A:             D
DO_SPOTD:                D
CONSENSUS:               D
CONSENSUS_MOBI:          D