Q5TZK3 FAM74_HUMAN

Gene name: FAM74A4
Protein name: Protein FAM74A4/A6

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95922 TTLL1 0.89236 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
2 Q69YZ2 TMEM200B 0.85581
3 Q9NRC8 SIRT7 0.8546 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell cycle GO:0007049
...
4 Q9NRA2 SLC17A5 0.85393 transport GO:0006810
5 Q4VXF1 FAM74A3 0.85286
6 P28062 PSMB8 0.85088 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 Q6QEF8 CORO6 0.84985 cytoskeleton organization GO:0007010
8 O43323 DHH 0.8492 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 Q5XG85 n/a 0.84455
10 A8MQB3 LINC02693 0.84379

                                           20                  40                  60                  80                 100
AA:                      MWRELRGCPGGDVETAQRLSQRRRGKSSEAVPEKTWRAQRMSQRRRGESSEAVPEKTWKELRNSETVPEKTWKQLRGCLQEDVQRVQRLSRRRHGESSKA
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             DD..DDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D........................DDDDDDD.DD..
DO_SPOTD:                DDDDDDDDDDDD...DDDDDDDDDDDDDDDD.......DDDDDDDDDDDDD.................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DDDDDDDDDDDDD.................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................
RICH_[R]:                  RelRgcpggdvetaqRlsqRRR                                                                            
RICH_[GR]:                    RGcpGGdvetaqRlsqRRRG                                                                           
RICH_MOBI_[R]:             RelRgcpggdvetaqRlsqRRRgksseavpektwRaqRmsqRRRgesseavpektwkelR                                      
RICH_MOBI_[ER]:                                                     RRRgEssEavpEktwkElR                                      
RICH_MOBI_[GR]:               RGcpGGdvetaqRlsqRRRG                                                                           
RICH_fLPS_MOBI_[R]:                                          RaqRmsqRRR                                                      

                                          120                 
AA:                      VHKKMWREFRGCRYCCTWLFFFG
STMI:                                           
DO_DISOPRED3:            .......................
DO_IUPRED2A:             D......................
DO_SPOTD:                .......................
CONSENSUS:               .......................
CONSENSUS_MOBI:          .......................