Q5T1S8 NCMAP_HUMAN

Gene name: NCMAP
Protein name: Noncompact myelin-associated protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- nervous system process GO:0050877

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13332 PTPRS 0.91122 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
2 Q5VVH5 IRAK1BP1 0.71081 immune system process GO:0002376
signal transduction GO:0007165
3 Q9UJ41 RABGEF1 0.60487 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
...
4 Q9Y3D5 MRPS18C 0.60049 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
5 O76070 SNCG 0.57223 cell junction organization GO:0034330
cell-cell signaling GO:0007267
protein transport GO:0015031
...
6 Q92854 SEMA4D 0.51793 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
7 Q9H361 PABPC3 0.49061 cellular nitrogen compound metabolic process GO:0034641
8 Q9Y679 AUP1 0.47571 catabolic process GO:0009056
protein transport GO:0015031
response to stress GO:0006950
...
9 Q8TEB7 RNF128 0.47301 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
10 Q9H4I3 TRABD 0.45921

                                           20                  40                  60                  80                 100
AA:                      MTTATPLGDTTFFSLNMTTRGEDFLYKSSGAIVAAVVVVVIIIFTVVLILLKMYNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVE
STMI:                                                  MMMMMMMMMMMMMMMMMMMMM                                                 
DO_DISOPRED3:            DDDD...D.............................................................DDDDDDDDDDDDDDDDD..............
DO_IUPRED2A:             D..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDD......................                     ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS_MOBI:          ..............................                     ........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_MOBI_[V]:                                                                                                    VtfspVdVqV 
RICH_fLPS_MOBI_[V]:                                                                                               VtfspVdVqV 

                                           
AA:                      TR
STMI:                      
DO_DISOPRED3:            .D
DO_IUPRED2A:             ..
DO_SPOTD:                DD
CONSENSUS:               .D
CONSENSUS_MOBI:          DD