Q9Y3D5 RT18C_HUMAN
Gene name: MRPS18C
Protein name: 28S ribosomal protein S18c, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q13332 | PTPRS | 0.64523 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 2 | Q5VVH5 | IRAK1BP1 | 0.61818 | immune system process GO:0002376 signal transduction GO:0007165 |
| 3 | Q5T1S8 | NCMAP | 0.60049 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 4 | P41091 | EIF2S3 | 0.5996 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q5VSD8 | n/a | 0.4945 | |
| 6 | Q96C36 | PYCR2 | 0.47465 | biosynthetic process GO:0009058 response to stress GO:0006950 small molecule metabolic process GO:0044281 |
| 7 | Q16690 | DUSP5 | 0.43005 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cellular protein modification process GO:0006464 ... |
| 8 | Q96PF2 | TSSK2 | 0.42134 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular protein modification process GO:0006464 ... |
| 9 | Q96K30 | RITA1 | 0.41152 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q92854 | SEMA4D | 0.40469 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MAAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKKCILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLC STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD...DDD.........DDDDDDDDDDDDDDDDD................................................... DO_IUPRED2A: ..................................................D................................................. DO_SPOTD: DD.....................................DDDDDDDDDDDDDDDDDDDDD........................................ CONSENSUS: DD.....................................DDDDDDDDDDDD................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... RICH_MOBI_[H]: HlvtaavsltHpgtH RICH_MOBI_[L]: LgrkkLthLvtaavsL RICH_MOBI_[T]: ThlvTaavslThpgThT RICH_MOBI_[V]: VVaVcgglgrkklthlVtaaV RICH_MOBI_[HL]: LtHLvtaavsLtH RICH_MOBI_[HV]: VtaaVsltHpgtHtV RICH_MOBI_[LT]: LThLvTaavsLThpgThTvL RICH_fLPS_MOBI_[V]: VVaVcgglgrkklthlVtaaV
120 140 AA: GKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE STMI: DO_DISOPRED3: .......................................... DO_IUPRED2A: .......................................... DO_SPOTD: ........................................DD CONSENSUS: .......................................... CONSENSUS_MOBI: ..........................................