Q5T5A4 CA194_HUMAN
Gene name: C1orf194
Protein name: Protein C1orf194
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UL46 | PSME2 | 0.5017 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | Q9NRS4 | TMPRSS4 | 0.49378 | growth GO:0040007 response to stress GO:0006950 |
| 3 | Q7Z5Y7 | KCTD20 | 0.49002 | |
| 4 | Q13976 | PRKG1 | 0.46738 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q9Y314 | NOSIP | 0.45725 | anatomical structure development GO:0048856 |
| 6 | Q14697 | GANAB | 0.44976 | carbohydrate metabolic process GO:0005975 protein folding GO:0006457 |
| 7 | Q9UJX6 | ANAPC2 | 0.44799 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 8 | Q9Y5S1 | TRPV2 | 0.39254 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 9 | Q86YT6 | MIB1 | 0.38749 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
| 10 | P41279 | MAP3K8 | 0.38479 | cell adhesion GO:0007155 cell cycle GO:0007049 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MPPTRDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFKNKSEILLNQKTT STMI: DO_DISOPRED3: DDDDDD....................DDD....................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD...DDD...DDDDDDDDDDDDDDDDDDDDDD.......................................DDDDDDDDD. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. CONSENSUS_MOBI: .........................DDDDDDDDDDDDDDDDDDDD....................................................... RICH_[D]: DpfqqptlDnDD RICH_[DP]: PPtrDPfqqPtlDnDD RICH_[LY]: LdnddsYLgeLraskkLpY
120 140 160 AA: QDTYRTKIQFPGEFLTPPTPPITFLANIRHWINPKKESIHSIQGSIVSPHTAATNGGYSRKKDGGFFST STMI: DO_DISOPRED3: ..................................................................... DO_IUPRED2A: .....DDDDDD..............................DDDDDD..DDDDDD..DD.......... DO_SPOTD: ..................................................................... CONSENSUS: ..................................................................... CONSENSUS_MOBI: .................................................DDDDDDDDDDDDDDDDDDDD RICH_MOBI_[G]: GGysrkkdGG RICH_MOBI_[FG]: GGysrkkdGGFF