Q5T871 LELP1_HUMAN

Gene name: LELP1
Protein name: Late cornified envelope-like proline-rich protein 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NVL8 CCDC198 0.51109
2 Q92800 EZH1 0.4965 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
3 P78380 OLR1 0.49493 cell adhesion GO:0007155
cell death GO:0008219
circulatory system process GO:0003013
...
4 Q13185 CBX3 0.48154 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
5 Q56NI9 ESCO2 0.47793 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
6 Q6UWT4 C5orf46 0.45687
7 Q9BPX6 MICU1 0.45232 cellular component assembly GO:0022607
homeostatic process GO:0042592
protein-containing complex assembly GO:0065003
...
8 Q9UJZ1 STOML2 0.4484 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
9 Q96C24 SYTL4 0.44004 cell-cell signaling GO:0007267
membrane organization GO:0061024
plasma membrane organization GO:0007009
...
10 Q9NP64 ZCCHC17 0.43917

                                           20                  40                  60                  80  
AA:                      MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE
STMI:                                                                                                                      
DO_DISOPRED3:            DDDDDDDDDDDD.......................................................................DDDDDD........D
DO_IUPRED2A:             DDDDDDDD.DD.......................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD.......................................................................DDDDDD........D
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................
RICH_[DS]:                SSDDkSkSnD                                                                                       
RICH_MOBI_[D]:              DDksksnDpktepkncD                                                                              
RICH_MOBI_[K]:                KsKsndpKtepKncdpKceqK                                                                        
RICH_MOBI_[CD]:             DDksksnDpktepknCDpkC                                                                           
RICH_MOBI_[CK]:               KsKsndpKtepKnCdpKCeqK                                                                        
RICH_MOBI_[DK]:             DDKsKsnDpKtepKncDpK                                                                            
RICH_MOBI_[DS]:           SSDDkSkSnD