Q5T871 LELP1_HUMAN
Gene name: LELP1
Protein name: Late cornified envelope-like proline-rich protein 1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NVL8 | CCDC198 | 0.51109 | |
| 2 | Q92800 | EZH1 | 0.4965 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
| 3 | P78380 | OLR1 | 0.49493 | cell adhesion GO:0007155 cell death GO:0008219 circulatory system process GO:0003013 ... |
| 4 | Q13185 | CBX3 | 0.48154 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q56NI9 | ESCO2 | 0.47793 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | Q6UWT4 | C5orf46 | 0.45687 | |
| 7 | Q9BPX6 | MICU1 | 0.45232 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 ... |
| 8 | Q9UJZ1 | STOML2 | 0.4484 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q96C24 | SYTL4 | 0.44004 | cell-cell signaling GO:0007267 membrane organization GO:0061024 plasma membrane organization GO:0007009 ... |
| 10 | Q9NP64 | ZCCHC17 | 0.43917 |
20 40 60 80 AA: MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE STMI: DO_DISOPRED3: DDDDDDDDDDDD.......................................................................DDDDDD........D DO_IUPRED2A: DDDDDDDD.DD....................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDD.......................................................................DDDDDD........D CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ RICH_[DS]: SSDDkSkSnD RICH_MOBI_[D]: DDksksnDpktepkncD RICH_MOBI_[K]: KsKsndpKtepKncdpKceqK RICH_MOBI_[CD]: DDksksnDpktepknCDpkC RICH_MOBI_[CK]: KsKsndpKtepKnCdpKCeqK RICH_MOBI_[DK]: DDKsKsnDpKtepKncDpK RICH_MOBI_[DS]: SSDDkSkSnD