Q5VSD8 YI029_HUMAN

Protein name: Putative uncharacterized protein LOC401522

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96C36 PYCR2 0.73698 biosynthetic process GO:0009058
response to stress GO:0006950
small molecule metabolic process GO:0044281
2 P41091 EIF2S3 0.7368 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
3 Q8WUJ0 STYX 0.72996 catabolic process GO:0009056
cellular protein modification process GO:0006464
nucleocytoplasmic transport GO:0006913
...
4 P25089 FPR3 0.72996 homeostatic process GO:0042592
immune system process GO:0002376
response to stress GO:0006950
...
5 P48960 ADGRE5 0.72981 cell adhesion GO:0007155
cell-cell signaling GO:0007267
immune system process GO:0002376
...
6 Q9UIK5 TMEFF2 0.71991 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
7 Q96KR6 FAM210B 0.7148 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...
8 O43301 HSPA12A 0.7131
9 Q5U649 C12orf60 0.70561
10 Q9Y5L2 HILPDA 0.69389 cell population proliferation GO:0008283
cell-cell signaling GO:0007267
response to stress GO:0006950

                                           20                  40                  60 
AA:                      MKLAKTAVLDPATYTSFSPGLSTCSSSQPPGDRRKGLLGCVGSGHCPLPTPAQFPKVQRPPTLLGGKNTSTQTTLHPVI
STMI:                                                                                                   
DO_DISOPRED3:            DDDDDD............................................................DD...D.DD..DD
DO_IUPRED2A:             ...................DDDDDDDDDDD.DDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDD.............DDDDDDDDDDDDDDDDDDDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[T]:                                                                             TllggknTsTqTT     
RICH_MOBI_[T]:                                                                        TllggknTsTqTT     
RICH_MOBI_[LT]:                                                                       TLLggknTsTqTTL